SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018742 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018742
Domain Number 1 Region: 385-497
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000144
Family PWWP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018742   Gene: ENSMPUG00000018862   Transcript: ENSMPUT00000019014
Sequence length 696
Comment pep:known scaffold:MusPutFur1.0:GL897226.1:994592:996682:1 gene:ENSMPUG00000018862 transcript:ENSMPUT00000019014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAEYVLCNWKDQLWPAKVLSRSEMSSNSKRKKTFSLEVQILSLDEKIKVESTETKILNK
SQIEALVSSLEAQSEVSSPPREETAYERSLKAALDILNEKTDLSQASSSDEEATSTLSQN
DLQNLSDSPPRKKYRKHEGDGDLSKCLEESENATSLSVANLENNDSLCDDKSRVHATIDT
LASEMETKSSENSSWYETFPSLSEDEDEKESKKKIDILAVMPLYSTIKEEDVCVKDEKFT
PTWSSDTFIVPKAVKEEAQDICPETLAVSSECSTFSENTEDPGEGPSNPCSSTSQNQPVE
SEAGAAASPRHCSWECQVSLSASNRVLDYSLLLRNNEGNLQRLDFEELGEELQASDKSAQ
LNPIDASILDDNEEDEELPRFVFNYEPRSFETGMIVWFKYQKYPFWPAVVKSIRRKERKA
SVLFVEASMNPEKRGIRVPFRRLKKFDCKEKQALVDKAREEYSESIDWCISLICDYRVRL
GCGSFAGSFLEYYAADISYPLRKVIKQDTFRNLFPKLHNENSAEQMVVTSQTKKMSFQKI
LPDRMKAARDRANKNLVDFIVNAKGTENHLLAILKGKKGSRWLKSFLNSNRFTPCIETYF
EDEDQLDEVVKYLQEIYKQIDEKMLTLIRDDKIKFILEVLLPEAIICSISAVDGLDYKAA
EAKYLKGPSLGCRERELFDSKILFEKRRKPLTNEAH
Download sequence
Identical sequences M3Z580
ENSMPUP00000018742 ENSMPUP00000018742 XP_004780021.1.14098 XP_004780022.1.14098 XP_004780023.1.14098 XP_004780024.1.14098 XP_012905121.1.14098 XP_012905122.1.14098 XP_012905123.1.14098 XP_012905124.1.14098 XP_012905125.1.14098 XP_012905126.1.14098 XP_012905127.1.14098 XP_012905129.1.14098 XP_012905130.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]