SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018888 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018888
Domain Number 1 Region: 174-361
Classification Level Classification E-value
Superfamily TRAF domain-like 1.5e-54
Family SIAH, seven in absentia homolog 0.00000001
Further Details:      
 
Domain Number 2 Region: 115-177
Classification Level Classification E-value
Superfamily RING/U-box 0.00000795
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018888   Gene: ENSMPUG00000019010   Transcript: ENSMPUT00000019162
Sequence length 362
Comment pep:novel scaffold:MusPutFur1.0:GL896965.1:2236409:2237497:-1 gene:ENSMPUG00000019010 transcript:ENSMPUT00000019162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRRPLKGAPSSVPGDLREARFRAAAAARRVPSVSVSVSVSALVPGPGPGPGPGPARRRGG
GDGAARVSLEPGCEAQRRPPEMKRQCPAALPPGAATCNPPQRLPSLAGTTVPNSDLASLF
ECPVCFDYVLPPILQCHSGHLVCSTCRPKLSCCPTCRGPLASIRNLAMEKVANSVLFPCK
YAATGCALALRHTEKAEHEEMCEFRPYVCPCPGALCKWQGSLEAVMPHLMHQHESITTLQ
GEDIVFLATDINLPGAVDWVMTQSCFGVHFMLVLEKQEKYNGHQFFAIVQLIGTHKQAEN
FAYRLELNGHRRRLTWEATPRSIHEGIATAIRNSDCLVFDARMAQLFAENGNLGINVTIS
MC
Download sequence
Identical sequences M3Z5M6
ENSMPUP00000018888 ENSMPUP00000018888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]