SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019123 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019123
Domain Number 1 Region: 388-484
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.25e-24
Family PWWP domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019123   Gene: ENSMPUG00000019247   Transcript: ENSMPUT00000019399
Sequence length 494
Comment pep:known scaffold:MusPutFur1.0:GL896929.1:286112:287596:-1 gene:ENSMPUG00000019247 transcript:ENSMPUT00000019399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLGTGPPPAPCRDPAPETSGPKPPPPLVPPFPPYFEGAPFPPPLWLRSTYRQWVPQPPP
RAIKRTRRRLSRNREPGRLALSPIRLRPRQVLCEKCKSTLSPPEAGPGPPAAPQPRRRAG
SVPGPDTEPRKLADPEGGGDSAASATRRSKREKRQEGKARVPRSPAIKISYSTPQGTGEV
VEIPSRVHGSLEPFCPSQAHGGGQDPAGPPASIPKLKLTRPGPPGTGLPPPKIRLKPRPR
GAGEREPVYRAELVEVLNGHGRGPRASSPARLGHGSAGRGPVDSSSGSSGEDEDFKPCAQ
ARRGREGLAFLATCPERGPGCAGESVWSSDSPDESRSSSSEVTFPDTCDLSSGDGASVRS
SSKHARQTVPPLTVRLHTQSVSTCVTGDGRTVAVGDIVWGKIHGFPWWPARVLDLSLSQK
EDGAPSWPEAKVSWFGSPTTSFLSTSKLSPFSEFFKLRFNRKKKGMYRKAITEAANAAQH
VAPEIRELLTQFET
Download sequence
Identical sequences M3Z6B0
ENSMPUP00000019123 ENSMPUP00000019123 XP_012911134.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]