SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MVEG_03407T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MVEG_03407T0
Domain Number - Region: 79-121
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00654
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MVEG_03407T0
Sequence length 245
Comment | MVEG_03407 | Mortierella verticillata NRRL 6337 hypothetical protein (246 aa)
Sequence
MLFKSALSALAMALVSLSAVQAHVSLQSPCARYRSTAGCPAPPPGQSVDYDINAPIGTKD
TINAPICKHKVPYAKRTVYKAGQTIQTSYAVGAPHGGGHCQWALSYDDGKTWVVIKTLIR
DCLKGVSGGQPYSVPVKIPANAPSGKATFQWIWNNAVGNRELYSNCADIEIKGKNGGSIK
GVAPLYANYGPGSVVIPEFGGANAPDGREAFDKRKPVTITVKASGAGQKKASAAGGKKKR
TPAKL
Download sequence
Identical sequences MVEG_03407T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]