SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MVEG_07116T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVEG_07116T0
Domain Number 1 Region: 62-191,382-528
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.28e-40
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 724-856,919-976,1039-1188
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 5.49e-37
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0081
Further Details:      
 
Domain Number 3 Region: 1577-1835
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.88e-29
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 
Domain Number 4 Region: 1362-1505
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000000000759
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MVEG_07116T0
Sequence length 2182
Comment | MVEG_07116 | Mortierella verticillata NRRL 6337 hypothetical protein (2183 aa)
Sequence
MNASWHRHAMGRQVRERSRIAQISSAILLVAMAIPTLVQAGPGRPSITTTEFRSSPRKLS
YFQDSAVVLLRDYDRNVHRSADEGKHWELVKGVPEGRATDMMLHTFDPKQAYILTGGKTQ
YKTTDYGATWTSFETENIPIGESHVLSFHATREDWVLIAVTNCEGHECHDETYYTKDGFA
SAPKRLLSNTHKCEWAYSSSLFDEAPVELIHCLEYKTRDGGMRSLDDVQLVKSQDFFVTK
ERVILGGLDRSAIVNFVTKERFMLAAEKHITTGDMNLWVSEDARVWAKANFPLGSNLRQD
SYTILESTSYSLVVDVKANADDAYGSLMLSNSNGTYFVRAKQYTNRNRREDLVDFEKIQN
VDGVYIVNIVDNHDQNPLEEREKKLRTQISFEAGSTWQYLMPPATGVDGRRFSCTPNTEG
TCSLHLHSVTSAKVSPPVFSSKAAPGVVMGIGNVGPYLLPREDCDTYLSEDGGLTWKAVL
EHPHKYEFGDMGGIVVAVRDDGNPVSYLQYTADRGQTWNKMDLEENMRPEALFSDPESTS
QKFLLFARNRDVSYAYHLDLTNIYDRKCERNDNNEGRSDFEKWYARKLGNNPDCLMGAKT
WYWRRKANAECMVQETFKDPSATDEICPCTDEDFECDYINNYVLRDGNCILEGKERMPNT
CKKEGDTYLGSSGYSLVPGNKCDREKGLKKDEGKERKCTAESIPSDITHSVTKFESPMGT
GFQYFLRSDVVMFLTGSSQAWRSDDDGSTWKRVLPDAGKFIGLSLHDENEKLAYLFTNDA
LYVTHNRGESWDRRDLPAPPNTFGYPLVDFHPDGDKNDWMLYLGQISGQCWTTLYRTKDA
GRNWAQVDTWVDKAVYASHREYDMPDHGIFSMAWKKPLPWGSCQNDLESTDANPLQMVYM
LDSDSNRLVHFDYVTQFYVVKKFLIVAVEKSNNFILQVSLDGKNFHQAEFPPNIRVDQNS
FTVVQSTTGSIVVDVAKSGVEGREHGIIFKSNSNGTYFSIQLENSNRNKFSFVDWEKIGG
IEGVILANKVVNTKSLSQDGEKHIQTVVSFNDGSSWETIRAPAGSDCDDCHLHLHSVTDY
NGPGAVFSASSAVGLVMGVGNVGKYLLPLDQCQTYLSRDAGRTWRKVNDRASVYEFGDEG
GVLVLADNAAPTQEAMFSYDFGTTWQKTIFADSPVLIQTVTTEPTSSISKITITGVQTGG
DTQFVISTLDFSARRNCVFDKGNKDKNDFEKWSPFEDSDDRCILGQDISYWRRKPDRPCR
VNDKDGSPEMEQSVCKCTARDFECDIGFFRDETGGCQRFGYDPEKPKKCDGTYKASAGFR
KIDASKCTGGEDLSKKTTERQCGVAIGVQSKVTTFDSRYREGSVFYFPDSDVVMLWFESG
VHISRNEGKDWDRVEVEGSIISLERHPYERSTAVITTAGHKQYITQDKGDNWDALDLPVV
PALSFRNYDFWSFHPSESGWFIFMGEKDCGYEGNNRCHAEAYVTRDAGKHWAGLADWVKS
CSWAQDNKFKRVNFQGIYCEQYADKSVSQKQLSQSTTRFVYSGDFMASVNTLYEEIVGYA
IYSEYLVLAEFVPGQSELRIAVSQDGLTFVKARYPQNFDVVNPAYTVLDSTTRSVFLGIT
TNDVKGYKFGNLFRSDSNGSYFSLSRKFLNQGDEGTVDFEKMKGINGVALMNEVMNPNDV
LQRSPKQLRSLATFDNGYTWETLNAPQTDVDGKNFPGCLSSEKCTLHLHNYLHRKHSEDM
FSTSSIPGMAIGVGNVGEKLGEYKEGGTFLTRDGGHSWKEILHGAHQYDFGDHGSIILLI
KDDEVPTDHVIYSMDHGQSFQQYEFSKDKFVIRDIVAKPNGIGKSFLLFAVPPAGSPNQA
RHVIIQIDFEGLVMPPCRLDLNDEDNDDFERWSLAGLRGEECMFGRKVEYFRRIEDHQCF
VGEIGVNPREIVKNCQCQARDFECDFNYAPDDKGNCVLIDNATPAPVNEKEMCANLPDGQ
NFYYLSTGYRKMAFSSCVGEHERFGTKVMCPGKGGGMGFFSWIAILGASGGLAYGLAVCM
NRNRSLFGGRQSFIRLGNDMYDQLPSRSSSLPTMNMPRSFSSLSRVRVPDFVYQVWDKIA
SLPVMPTRVTNYFNRVRYQNLSQEPSEVIMDDYFDHYLDDDDDGANAADGDPLVGRRGDS
DAQERYRDDSDDDASEDLDGMV
Download sequence
Identical sequences MVEG_07116T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]