SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MVEG_00344T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVEG_00344T0
Domain Number 1 Region: 2498-2792
Classification Level Classification E-value
Superfamily BEACH domain 4.19e-121
Family BEACH domain 0.0000000179
Further Details:      
 
Domain Number 2 Region: 2852-3143,3211-3241
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.16e-27
Family WD40-repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 2332-2383,2410-2459
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-23
Family PreBEACH PH-like domain 0.0073
Further Details:      
 
Domain Number 4 Region: 904-1093
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000121
Family Trypanosoma sialidase, C-terminal domain 0.05
Further Details:      
 
Domain Number 5 Region: 3251-3308
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000331
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0072
Further Details:      
 
Domain Number 6 Region: 205-240,331-450,480-508,582-635
Classification Level Classification E-value
Superfamily ARM repeat 0.000023
Family Regulatory subunit H of the V-type ATPase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MVEG_00344T0
Sequence length 3317
Comment | MVEG_00344 | Mortierella verticillata NRRL 6337 hypothetical protein (3318 aa)
Sequence
MASAQLVRAIQSVQSQELAKKEASIAYMKVLRKTENFNALKAIDILSKAPDNLLAILAQQ
RVHSGLLDVFLTFVEFPSQEFDEYVAQGVASILVVSTLTNALKRLLWRKPVILVLIENDE
LYGLFEALVIQRSASVGDDPAELYIWKARVMDVVDFVVETTETDVMPYLHSKHCAKLLSD
ALREYLVDGSIDSVHREEGILILRIIVKLIKKSSLMSSVLLDDFKANKIYETLAMLLVSP
PFDEDMLTFKYTIISLIEELVFIDKEALPPPEEGTPYQHQDFALPVVGPEHAGAVVRNME
ACQVLVTALLYPDISAMTLLPVGNKSQGAPPNAFSLTVFATLLSIIKDHPMNYFLLERLN
ILSYAIERLDSYHPELQTSVMELFTFVVKDLNYVPFRDLVILSIHFQGTSSPRTTALVCD
TVAGLLQTSPGFKDVLREVGLIDMFCNMLEELSIVLRETFGSPNFNNRMSIVDFGQAFKP
GEQKARKYGIEVVHHFNSIMGCLVELLRGSRKNIALFQSTFRGDLFSLLHYNETRDGILR
VIVVLVVESYRFYLEDRDSSSRSPPTSGNSSSTSKIMSAPSQLTQLCEILQSLNRYDFKM
KMAILNALNEVFLECPELKDVFREGGGYVSIVSLLIRLEDAYVVIDKFEKSSMPKRRQRR
DPQTDERIPTKADMIELFTKVFSVLSESMRDHPGNNNYFEEHIGFGSLADALQLTGVFGP
HGDAASMLGILFAFAIQNESVLNIFDDPEEVENTPEMVAKWLNSPKICVQNSHVVLGIWK
ICMNLQNQESLAFCGMMSLFALSCANRRNQVLMGQTGLLDELLRALFDSPTQLALENGND
NSSDENNVMRDIMSRLSKRLIEMGMSSVGFRYLMEKFSATKEISFGECSGLLDMLLHGVT
HSRWPSFVQFDGYSRLDLRSLGNHNFPPTSGYTFLAWLCIESFDDELAIQILEISDEDQR
CFLSVEIEAETHKLVVSVSHHHSVSFNFAFEIGRWYHLALVHAKPKLTIPGGSLSVYIDG
ILGDKIKCGYLSSPSGDVKGYLGRHQKPKMTSKKEGSTLSWNLGPCYLVDEPLDVQIMDV
LYNLSPRYHGNFQDSLGKFQTYETSTALNINLEAARRRSSPSSRNHEEQVALMNAIRGTI
GNSIPEDKLVFAFSGGNLLDSADTRTVGALAGIQQKDQFCRILFNSAIPRIHRGINPLSA
IGILVGNPLVAAPRGLDDSIWKVGGCVVALRIVESAKDTATLEKAVLLLDQLIRCSWRNS
EDMERIFGYEILGYILKQKKTLFSIEMMNTLLSVVGMDLEYPDDSVITNSFAFRHLMLDL
DIWRKTDIEIQLLHLEQFKIFLQHSHKSSLNVKRLSTMHVVKKMLAPLRTGNYPVVQLPH
YVDAMKTVVFNHFSTETVRNLATFLVSTLKQTNSIRSLSVSSRHPDMKSEDLDGSKASLN
IDILSDPREKPLPSTMKHAVMGNAIMEMLEQILCERGNVDYVHKFATTITNKWTLLFIEN
PGNPYGAVLAMRILARLLFTQGPAYLAKFRASYGFLVLQSYIPQFWNVVPMIHVVISILL
GVDVCDVPLRAPLDTETLHTLYGDAPEANRTICPDILPTIMVMLKNGVAAAVTPVAPVGK
GGVDQDRSARVVETYQTLIEFFTEMQTNSRVFKEIFVRADFIDELAGILFPFICHSTKAM
AVESELDHIASEPAPPADISSAEAGNEEATTSNRSSKHSSRSSFNATESVTDAESTPITS
VRSESPPATASTSNLSLNASQTSSSLLQVSQTFSEGTLRRTPSSVSIGRVREVDLKIVRE
PIALSLLKLLVVISIDSVLDSAPRSMTAIELLLQSCPPAYKDHQIYFQSFLLGHVVIGLE
QNIQAQPEVLADSRVMSNVVQFCELIVDLTCQNWFVGSYLIQFDLIANVLEIIFQDARPD
AVRTQLTSLLYRLVCYTLGQCQNGTEIQTAKLEALLDKCIYFQKILLSSSPGDVEFMKCL
ILHLFSFLPDADQKTRSTMMILIKLVFLMRPIEASGLLKLKPTNPSDDEDSADEGYSALV
EGNYPEFVKWRAAHNAELEAIFVEFRKSWDAMMSIESRVSEDSQRQQYNRRTQKLKRLFR
RQHLERSILQQYKLKTHGWTRSIQEMEEVRYAKSLQDLDDHVRFVKNEWKNLVRDVCRKG
AIWEDKDPAKAVPLKWRLDFTEARSRMRRKLRVDERKTEEPYLPKQGGSALEAKISSLSI
PKNVKSSPIPGQAPLKSKIDKLKEADVASVASVDKSQDAKSDKDSDHGVQDGTNTSDSGT
LPENEEEVTENGESIPTNADADLEDQDRDAEPAFEEAANRKILRLLEAGDVVYEVYNMSR
VTGLDAVEGLLLLCKHNMYLIDNYFQKLDGEVVDISEVADSERDQYLQLLASNAPASQPP
SDSSEVRHQCRKWRFEDIKEVHRRRYLLRNVALELFFVDGRNYLINLNLQQRDLVYNQLA
SRVGSLATNSLQMGDRSAMIEPNNNSNQSQTSLGSKLANIFAPSSIADITAKWEKHEISN
FQYLMHLNTMAGRTYNDLTQYPVFPWILADYTSQELDLTNPKTFRDLSRPMGAQTPDREK
DFNDRYHTWDGGDDHTPPFHYGTHYSSAMIVCSYLIRLEPFTQEYLKLQGGQFDHADRLF
HSIGKSWVSASQKTMSDVRELIPEFFYLPEFLMNTNGFNFGSLQTTGEQIDHVSLPPWAK
DDPKIFIEKHREALECEYVSAHLHEWIDLIFGHKQQGPESVRAVNVFHHMSYEGAIDLDT
IDDHIQKSATIGIIHNFGQTPRQLFKKPHGPRLPPNRDPLSANYYNIASHAEYLTQSVIP
VKDIGLPVGEIIYQGDKPFVGHSQRTYEPYACSKYVEWGFSDNSVRLYLTETNKVLGIFE
NLHLEAITSVKWADDRTIVTTSRDTVVCIWRIVQNRSYELKLMKCLRGHRETVNTVAISV
AYSIIVSGSEDKSCIVWDLNRLEYVRQLGKHEDGVRVVAINDATGDIATCSGPVLRLWTV
NGDLILQKYTTQIGDPILDCVFYAGRTGEWVSREILFTSHRRGTIKVWEKAVIDGQFKNT
HMGSMSISSLQTSLDSMVLTTESPSSAGNGSTALASSHQSRNSTSTQTSVMTGAATVVGD
DGLTSVSTPGHGRERTMSSNHHGFRDENGSLGVIQEIAEDQSSFGERTRQSSHTTSSTST
VASNQAKNRVAKWALRLRQAYTYEDRLRVDGGVAPNIVSLYVSSARRALYTGDSLGRIFV
WVLPDGSGCSHWMQAGRDTVCVNCQTRFPLLERRFNCKTCGGVFCGTCTFVPISGFAEKQ
ARFCFKCSGGKLKELMG
Download sequence
Identical sequences MVEG_00344T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]