SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MVEG_01034T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVEG_01034T0
Domain Number 1 Region: 804-889
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000031
Family Ras-binding domain, RBD 0.0089
Further Details:      
 
Domain Number 2 Region: 919-1026
Classification Level Classification E-value
Superfamily PH domain-like 0.00000181
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MVEG_01034T0
Sequence length 1086
Comment | MVEG_01034 | Mortierella verticillata NRRL 6337 hypothetical protein (1087 aa)
Sequence
MIRETSQNADLDYEQMMGELAAMKTDLAHRQASRSGPRSTAPRTPGDGEPRRTRTRRAPT
APSEPRPDLSLSVDAVSTETPPDATPVSPLSKRPDQQDDHDHDSQNQSHRQNQQDLKNLS
DPSMTIDAANPVARLGTVQTLDDPLPPQPNQEPKGSELSGVTESPFDGRRPLPPKSAQRS
RSISHQSGRPLNGVQDNDREPDSSSSAPSTPQEVMTPTFGASAPRKFLRPYPSSPSLSTS
SNQSPTSPRLPARSNSRRQPQPIVPTVSPSEAHQPYGGAPPVIPPRSRSGSRSLSRSNTI
TRPDGDSIYPFPTQTPTIAEDGETSSLPPSSSPQPEQQQEQPQAQQAQQIQPEPQQPPQL
SQLPRSEQSQQPQQPQQPQQPQPQLQPHLQQTLEPAPENETKDLSSAPGPGHSRKKSSSN
VLRRLNEEDESQPLAPSLLPAEPVPHLPSHHNFQQQQQQQQQQLHYHDNESGRPTLRKQK
SADPGAMYRQQEESSLAPGRLPSRHASERRPNRDRNNSSSGAAFGEPDQSERGRTQSKEE
GSKGGLFKWVRSRSKSKDASLARLNYDTSHPVPEQPAYTEYNPALIPSRSVSTVGGALRR
DKSIPRKASNQNFHPSGDGAWPPYSPGSMSGDQELSHNRKKSLSRPGPNGTIIPPSLHRM
ASNPALDGSGPQMSLNISTNSNTTYHENMIRGMGMGSTPITPSVLLTPQPSFPTTGTPSQ
PGSMRGMALNMMKEDDAKYHAQENQQMQQQLERQQLQQAQLQHLQQQQQKLASAANSMSP
PGTPTRTAAPAGPLSPVAPTVRLVATRIYVQTETDFKSVNLAPNTTALDVLHMLQQRGCF
GEPGDGRYHDRWTIFEYSKEFMIERPLRDFEVVLDVIKTWEADKDNKMICKSFPARDELA
AKEIVRLVGPAGQASFVRPHGWVHLETKKSKWVKRYLHATDTAVYHSKDSKFNGESMLCL
LRNFDVYAVQVPRKKAPTKFGFALKSTDKIHLFETPEDDYIHYVCTDSGESLREWLVGLR
ASKGIHMYHANPEVIREGQKHALELQSAEADGAMNSRGNLTEEQVRSAEAKLAGWGMPLG
GGAAPR
Download sequence
Identical sequences MVEG_01034T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]