SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MVEG_08048T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVEG_08048T0
Domain Number 1 Region: 234-298
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-21
Family DNA-binding domain from rap30 0.0021
Further Details:      
 
Domain Number 2 Region: 44-165
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 8.89e-20
Family Rap30/74 interaction domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MVEG_08048T0
Sequence length 373
Comment | MVEG_08048 | Mortierella verticillata NRRL 6337 hypothetical protein (374 aa)
Sequence
MSDIEQPSRKRPADFEELFEDGTETKESYESEDEVVDEDGNVVGDLDLAKAGTQAWLVKI
PKFLADRWSTVNKEGVDLGKVRIFRETNPNDPNAAPFQLLLPTDELTKNLPKTYTLNMST
NQVTNTFVFTEPTGPHPKPPHAPGYPTGKATSILATIKHECAVTPQPGSAEYREIMRERN
IEAAKKGGRSVQYLGESTKADPQGQRGSMFLPGVGIRSGFIQKKVKVQMDQKTTRMPRNE
LMDMLFSAFEQYPYWSFKGLVEYVKQPQSYLKEVLSEICNFIKKGPYTAKYQLKPEFAGA
AGRAAAASGIVPSGSSSGSGLASAENETTFNPAAVGVGSGEVATMAEGDLQGDMDDDDED
FDDEDDDMVEVEV
Download sequence
Identical sequences MVEG_08048T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]