SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MVEG_08063T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVEG_08063T0
Domain Number 1 Region: 713-776
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000272
Family DNA-binding domain from rap30 0.0061
Further Details:      
 
Domain Number 2 Region: 558-647
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.000000017
Family Rap30/74 interaction domains 0.01
Further Details:      
 
Weak hits

Sequence:  MVEG_08063T0
Domain Number - Region: 174-216
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0545
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MVEG_08063T0
Sequence length 841
Comment | MVEG_08063 | Mortierella verticillata NRRL 6337 hypothetical protein (842 aa)
Sequence
MDTEADQYVLTAEDELDLDLTLSSEANIAGNGTNYHDSMLELEHALEEETRDITDRFSNE
RRPEPTGLDRALGSSNYRSTQRERQNEQPKYASRSGGFVTGFDPLSKEEREKKASRAQRF
GAISQHTEVKEQTVGEESGMDVDEGDWKRPTDLPETPPRTSMIRLESVHLYGTNEMSTKD
VLKYFEAYGPSHVEWIDDSSCNVVFKDNYSAKRALYYQLVDEEANFGEDEEEGALLDVEP
ARPLGDDAAAVLVPRSNNRLQRAKEYIPVQQHNQPMIQNNKGLYLRYATDFDVKERGAAS
RSTYYQIHGREESKRTGSSNSRHSNSQHQYGRRSRADEDEVWARGRDPGIRTFSSLRRKM
ERGSESPSPSRHRSWSRNRLLTGSRSRSRSSSRSRRSDRSRSPGLGSLRDRASRSPDSGR
FRSDDYGNRGRRGDISLRLGGRVTQPDEVSSLAVENRINDLADDFLSELESTFTRREKTI
PKSRTLYSDFYEKEYLTEAPTRSRTNEGVERQPMSRDRDDYRRRDYSPRRSNGGGRRERG
RGGRDKSEALKAVEGTILQVPDFLIKHFNAFNQDGANVGIVRVHATTKQYQLILSKEEAA
ESIPQVYDLTFHPEQTSNTFVFGEPNAATGDAASICATIVNEGNVLPPPGDPSYRQILRK
REERRRSTMFLEENLTGRPSAETVGGMFMPGLARPKAFIHKTADPKQTKDGKRARVPHNE
LMDDVFAAFAQYPYWSKKALVEQFYVPWAQLKEMMDEVCIYHNKGEYIGNYSLKPHLSGR
FDDSVSATASAYAASPQQYEAGAGSTSIETVGEEDLSDLTDKEELEKYEARLRRFLEAWT
C
Download sequence
Identical sequences MVEG_08063T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]