SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MVEG_10104T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVEG_10104T0
Domain Number 1 Region: 25-124
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-27
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0012
Further Details:      
 
Domain Number 2 Region: 170-271
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000119
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00055
Further Details:      
 
Weak hits

Sequence:  MVEG_10104T0
Domain Number - Region: 356-364
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 459-501
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 0.0471
Family Methenyltetrahydrofolate cyclohydrolase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MVEG_10104T0
Sequence length 513
Comment | MVEG_10104 | Mortierella verticillata NRRL 6337 hypothetical protein (514 aa)
Sequence
MPSITLNNPEDKATVKRFLSLPDTRIITATVARLYIAYPDPNQWTYSGILGAVALIQTSN
TFYLRIVDLLYGKGVVWEQELYKGFVYTQDRPFFHTFQADNHVAGFSFADEHEADVFYGK
VFGRAGLRPFKPVPSAGALAKSGKAGGGQGRNKIPMHNGKLDKTRIGLPSDFRHVGHIGW
DPDVGFDAQNIDPSWRTLFEQLDKFGVSRQQINENATFITEFVNARGGPVAAGTGAPGSG
TGTEDLARIDSPPRQTRSPSPLQQRRPPPPPPPVQTSTAASLVSPAPFHGYLPRPLAQVM
ASLSFGSSTFYGSSSSTTVASAPQSPQSPKAQPQIDLPDPSPHSEIQRATSPPPPPPPPP
PPPPPPMSPSLRTKSPGVGVPPLSINTGNLGSGAHGQGNRPTVTIAGSRGAPGVTLGGEG
APAVLKSPVESSLLASIRESGGLAGLRKTGGIRSPPPREKLVSYASSNSLAHGGGSQGDL
VSALVAALHRRQTKLTYSDDEEQSDDAWDVDED
Download sequence
Identical sequences MVEG_10104T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]