SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2000176560 from Sludge/US, Phrap Assembly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2000176560
Domain Number 1 Region: 22-382
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 5.75e-74
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2000176560
Sequence length 387
Comment Uncharacterized conserved protein [Sludge/US, Phrap Assembly]
Sequence
MNRLFALLWIALLTGCAAPPLRGTGDLGLVIERASGQVTLVDTSRREPYARIGGFGDLSH
ASVVYSRDGRYAYVFGRDGGLTKVDMLTARIVRRVLQSGNAIGGSISQDGRIVVAQNYTP
GGIKAFDAETLELLSEVPAEYAPGSFSKVVGLADLSGNRFAYALFDGGEIWVSDFSDPRR
PRTQRYPAGLQPYDGLVTPDGRYYLAGLFGEDGVALLDTWQPEQGSRRILANYGRGQEKL
PVFKMPHLRGWSLAQGNAYLPAIGRHEVLVVSGSNWREVGRIKVKGQPVFVIARPDGRQV
WVNYAFPDNGWVEVIDTLTGQVVRTLEPGKAILHMEFTPRGEQVWISARDDDKVLIYDTA
TFARIGEFTAQAPSGIFFTSRAGRTGF
Download sequence
Identical sequences C7RJ57
2000176560 WP_015767841.1.47741 522306.CAP2UW1_3408 gi|257094956|ref|YP_003168597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]