SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378708781|ref|YP_005273675.1| from Shewanella baltica OS678

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378708781|ref|YP_005273675.1|
Domain Number 1 Region: 39-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.17e-33
Family ArsC-like 0.0000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378708781|ref|YP_005273675.1|
Sequence length 152
Comment arsenate reductase-like protein [Shewanella baltica OS678]
Sequence
MLTLSQQNIPLVTCGAQCHNACKINACKPSVHPHWSIILTLYGIKNCDTVRKARKWIENH
QLPVHFHDFRDDGLRQEDLEFWCNTSGWETVFNKRSTSFRALSDADKTDIVQAKAIQLML
AQPTLIKRPVLVVGEHVLIGFDEAAYKRVFSL
Download sequence
Identical sequences A9L3M7
gi|378708781|ref|YP_005273675.1| 399599.Sbal195_2469 gi|160875581|ref|YP_001554897.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]