SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378710349|ref|YP_005275243.1| from Shewanella baltica OS678

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378710349|ref|YP_005275243.1|
Domain Number 1 Region: 53-169
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-35
Family Thioltransferase 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378710349|ref|YP_005275243.1|
Sequence length 170
Comment thioredoxin [Shewanella baltica OS678]
Sequence
MGEIIITQPLNNRPLAQYISRIDILFWSFAMIIACPHCDTLNRVPDERVNQQPTCGKCKL
SVFTAAPIELTSANFANHAKKSELPLVVDFWASWCGPCKSFAPVFSAAAKTWEPQFRFGK
INTEEQQALAAQFNIRSIPTLMIFKQGKILAQQAGALPQSALNQWLKSHS
Download sequence
Identical sequences A9L4S3
gi|153002412|ref|YP_001368093.1| gi|378710349|ref|YP_005275243.1| 399599.Sbal195_4029 402882.Shew185_3906 gi|160877133|ref|YP_001556449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]