SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|NCLIV_036510 from Neospora caninum Nc-Liverpool 6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|NCLIV_036510
Domain Number 1 Region: 78-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-28
Family Thioltransferase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|NCLIV_036510
Sequence length 182
Comment | organism=Neospora_caninum | product=hypothetical protein | location=NCLIV_chrVIII:5154581-5157294(+) | length=182
Sequence
MATLRRSVTSLLATRSPVFPSSAVSFSSCSSTSPSFIALRPRFSPGATGALHPQAASAET
GNRLCGGFLQVRTVVNRVKKVEDFQKVTDSHEDTAVKVVQFSASWCGPCRQVTPTIEGWS
EKMPSNEVQFFHVDIDECPELAEEYDISSVPTFLFFKNGKKVSTVLGGNTAKLEEAIKAS
TN
Download sequence
Identical sequences F0VJF8
psu|NCLIV_036510 XP_003883901.1.31604 psu|NCLIV_036510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]