SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|NCLIV_020770 from Neospora caninum Nc-Liverpool 6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|NCLIV_020770
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.79e-21
Family Chaperone J-domain 0.00092
Further Details:      
 
Domain Number 2 Region: 134-244
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.15e-19
Family PDI-like 0.0084
Further Details:      
 
Domain Number 3 Region: 397-505
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000561
Family Thioltransferase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|NCLIV_020770
Sequence length 521
Comment | organism=Neospora_caninum | product=hypothetical protein | location=NCLIV_chrVIIa:1274960-1281688(-) | length=521
Sequence
MPKPAYRKLAKQYHPDVNPGNEEKFLDIAKAHEVLSNEEQRKKYDMFGEAGLGEGGGPSP
DGSGGVPVDFADLFGGMFGGGAGGPNIKITFGGGDGPTFSGAPEGFGNFFSGGGHSGGFQ
EAPSNNASLYDAEDDEVTELGPQAVHRLIDGRDFVFFLALYNPRCRPCRQLKDEFVKAAK
RMKGIVPFGAVNCSRFGNLSYCQEAQHYPTLLFFPADKHSKRIDYRGERTAAAMVRFLSE
NLPSTVVVLTDESAETWFSTDPQIPKVVLFTDKRGTPPLFKYLSYQMRSQVAMGVVFKNQ
KNLLKAFGEGLEYQRTHQPPKPGAKPLPAEIIFPSLLAIDDIDRLTGEWIDVKNHVNQEL
LTLTLSRLAAKARTASGVSFRELTARRMASGECGKDDSQFCFVLLVPDAMGARQAPKDIF
AKLTELSEKLKRDPLKICWVNKDTQPGFTRVFSLPVDQEVVFLAYRPKRKKYEVMTSAPT
PSSVESFVNDVVSGGKQLTKKLTQFPQLARKQAKVPGHDEL
Download sequence
Identical sequences F0VEZ6
psu|NCLIV_020770 psu|NCLIV_020770 XP_003882322.1.31604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]