SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|NCLIV_021140 from Neospora caninum Nc-Liverpool 6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|NCLIV_021140
Domain Number 1 Region: 1387-1453
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000524
Family HMG-box 0.0024
Further Details:      
 
Domain Number 2 Region: 1094-1166
Classification Level Classification E-value
Superfamily HMG-box 0.000000367
Family HMG-box 0.0024
Further Details:      
 
Weak hits

Sequence:  psu|NCLIV_021140
Domain Number - Region: 2337-2381
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000187
Family Myb/SANT domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|NCLIV_021140
Sequence length 2488
Comment | organism=Neospora_caninum | product=myb-like DNA-binding / high mobility group box domain-containing protein, putative | location=NCLIV_chrVIIa:1599393-1610977(+) | length=2488
Sequence
MPPGVSPQRPAVLDDMESSRPTSLSSRTDPSSESFSFRYPSPSALFDPGKGGEASYAPCS
SLFSFSSNARCLVKTRDTIDFDSLSHPSHLSSFTIPSSSLSRSYSLDSTQRKADQDSPTH
APHSLLHTDIFSPLASLFSRRSGCTPHVCADGRDRRSSVPPRGSGPGTEATESAPSLASG
AATLRPKDGSPGGRLPERGTAAQNAVSREPARPSASCRSPSSDLSLLFAERELPQRSANG
ENSGEIVTPFGEGPARLSPSLSGLPTALTLGACTLTQGGSTWDCRPSGEDFPLRFVPLLH
AEPVRGGVEQAVPLDPGPLAWSACPFTVDPLAFSLSSTLGEGFCSPSVADPSLSLHVSVA
ALAVALKFASAMPPPSTERGSGGVAPKGSSSPLRPEKEAESEREKEQALVRAYLQETQRR
RKAQLESEEEANALMPLGAVTAASKKQHDELFQAFHVAHRVADSWVERLASGQDWGKSIP
RQPAGREPETQTNPGCSADVTEKRGEASGLASCLGGTPDCGQTDSDGLQEPLETRATDSE
GRNQDKGEAESQGDAPEKPRLAWEAAHPFLSMKLSCRPSSAARSVLYKALRGVANDLAKT
EQIARHLREKTEPSAALAPSPSVPSPGAVSGEPDALLESSGSGATSSASADSLLGQSSLR
TASSPGGEESKESTGESWASGVGGDGASSLSFLEEEEEAEEAEVQQLVRRTMLLRCLRDL
LGEHRSLSLQASAALGVSPASKSESPSTSSSSTAGSPSSASSVFDEEKLRQERILSLLLR
QVERHEDRQVPALLLSAATPKPVKQHLVQVLLAEVLAEISVTYHQERLHFLHRPLSKPIK
GLPSGEKTPASLAFASASASLGKGGTQPGLLGNPLTPSHPPADGCASLPVDLAGPSPLSI
LQCLVRAQRAEAATAEVQADVVAAGRAALLRLAQLAPRLTACVPLLLPYLPHLPRLLHVQ
IQLLAQQAQRGDLTAKAVEEKLLKHFKDQEAFACTPFLSTLSQQLTECLSASRPTLPAPG
VAALSGLAPGAGVPQAVASGLLAPGAAPFLLAQGAGGERGLGAVGSLAPGLAGVNAARDD
GRAASAQGGPGGKPAASAAKKPSRKGMGMSGWALFAKEKRAELQQEGRLEGETLPEQTSF
VARFWHQLSKEKKAEWGRRAEELNRQAGLRMKKEEEIRKMKEAEAEKKRAAEAAATALPG
PGLATPLREHALNLTFNQVLGGGLHHPSLAAFSAPKSALPGGVYAQAGADDRAQPAPLSA
GKGTAGPATRVHADGPVSFGGRAPPNPSTGGGLPGDGVSQAAAQAGEAAAQVSAGFARIP
QPQGHPSPFSASVPVPGATAGVARAPQRPLEGQGGAPGAEFPAAAKKKSRSGGGGKKGEG
GQAKGGRGYTAFTFFAKEMRQKCKEEGIECGTSLSEQNTFIGDKWRQVSPEEKKIFQQRA
KEANEAWRREHEEKLQAQQKEEHARRQEASADPALAFSAPHAGPNPSTGPPQAPGAAPSP
SIPASAAYSSFPAYSSPGQAGAYQPAAGPGHQPPAQGYQGAYPSSASSLQERRGDRESLD
AFGHTASHLTLSHTASGPGSSGPARLPPEQARGDSGAPSQPSPYPAESRALFSASPSSFS
AAAAAPGEEEGARGRASSLDSASPPLKKRRGDGSDEQPVSGPFVSSVARAGVADPKSGAG
GGVGTPERGEMRAGERDRALSVEKPGVDGRERQAVYPASPLPSSANVGQTTYSMGSRVGP
QRVEVRGVASAMMTPEAQWRREDEAFSHNQVPSVPFTPPPSSMPSFSPKAPPSPFASEPT
FGPRKQGLPVAHPALASLAYPPEEVMYQLKFDSPFDGEEGRRDEDREEERGRSAYAAGDR
AMQDRVDYFVSEQVHSAPLPSRRSARAASRGALERRSPSERAEETARRTSEDAASDGDSD
AESAEEREGESSGEGAEPRKGPRSVAGRGKRREHPRTRTRARDREGQDEASETPQLVTRC
RLGASGRNARQSDEAAPDEGDVDEGEAEEQDEEWEESGDYTSDEEFVPASRSHSTSARKG
LTRKASLSSSFQRRGEDRAAQGAPGRGQRRPGAVTGTAGEPKGSGDEETGEVGRARNTHA
NRKKRDCPTQSSRARARRRREDGKELLQLSLPASIVEKEGPLTLWDLIQRNKRRPPSSAR
GGQDAGAKAKAGASGKHGGREEQKEEADESFDSVLGSLFSAPPAFGPASLNSGADQALQP
LLAPASPAGDRKGREEDEGTAEKDLSALFDTPGQGSAPALRLDADGQLVMAEGGEELEPP
VCTCGASLGLFDGLGQAAPCVCLFNGRRRLVEEGGPGGVNGLSLQPYAGAYKSTKGKRWT
PEETQRFYAALEQYGTDLLLVGTLLPHVTDKQLKLKLKIEERRCPEKMHGKINTALHYRR
ALGSSSSDDSDGESESPRNQIVDSPAFPQPALPSAPAQGSSFPALLSILAGASVDAPAPA
ENADVDPSLFALPLDGGTTGDDLLALFG
Download sequence
Identical sequences F0VF32
XP_003882358.1.31604 psu|NCLIV_021140 psu|NCLIV_021140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]