SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|NCLIV_042900 from Neospora caninum Nc-Liverpool 6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|NCLIV_042900
Domain Number 1 Region: 872-925
Classification Level Classification E-value
Superfamily RING/U-box 2.14e-17
Family RING finger domain, C3HC4 0.0044
Further Details:      
 
Domain Number 2 Region: 558-635
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.00000000000222
Family Cdc48 domain 2-like 0.00067
Further Details:      
 
Weak hits

Sequence:  psu|NCLIV_042900
Domain Number - Region: 488-555
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.000425
Family Cdc48 domain 2-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|NCLIV_042900
Sequence length 988
Comment | organism=Neospora_caninum | product=hypothetical protein | location=NCLIV_chrIX:3714996-3719638(+) | length=988
Sequence
MEEEKEAFQNRAGSAATQSDSGCSASSHAGANAAGTPMAAENSTPSLQPLQKRKLEKLHV
LPIGHKAADREVFAVLKKMMADDVLLQQYLAFEVPVRGTESPGELEMEEPSRAETSTGNE
ANTLSSCTYIVVDCCPRSGYVGTDTLVFLAGKPLQPLRRVQLLALVHPNSSYAHRAGIHT
YQQLFEQAPSFPSLDRQEPYVEDSAAVYTLSSVNLPSTVASTRSGHLLSPFTPAFLTGRQ
AGPDEEFPFGFTDIIEDLESASSNTSTSDDETGGLGAAPPGARFRGPDDCGRRGFSLQGP
TVPRLASRGDVTEVGEGDSSDCSGVTTNGRPESFESQQSAASSSTRATEGRRGSRGSGDS
RRGPEIRGFSAGCSSAEAPPSQNGEDRPCPAGSNTEEQTRQSVPVVASEGDTSLSRRASA
AERRRLQRRRLQHSQFFEAEPSAGNRRRGRLPGTIRVRLRERMSAVHAGGLGSGVCRSGK
RLDRLDPETLFREFVGPYLSSRMYGRRGRTRSTIVLYPGKKLVVGDLTFVVWATDPRNSP
GFVDENTSIYISLDPYGEFKRVHFVPFSDTLPTTYRFDFYDDYLKPFLLENTWRNFTRGD
VYSYRGVEFKLIATEPVSSTIARVGPETTVYYQGTVEPTIMDLLPPDILHRIRRLPVRLQ
PFAVVSAAQALDPQVLMRVIPAASIRGPRQGINEQMVEVLRDRLVHPFSFVAYLRAFRDL
CERKLPSEAKREESQQRHPDVPADSPKRQDGMDSRMQDNGPQESSAGVTNISEQPSEAEK
REVEQTEDKASSVPWGMVHPTAFFDAASFVCETGHEGGPSEERRTPGEEKNPEKSSRQAA
GVTGDEGKAGATVSPNEGAAGGKPSPSLCEDEFERPSCTVCTLTLEEGDLSIVLPCGHVF
HWQCAHAWLRCNSTCPNCRADINVLLKRDNGEGSESGVASRLRRSTRERLQSDRQGTDWH
RRSTVGEQENRPGGLGDAFRSWFGSILS
Download sequence
Identical sequences F0VC89
psu|NCLIV_042900 psu|NCLIV_042900 XP_003881256.1.31604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]