SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G07410.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G07410.1
Domain Number 1 Region: 26-123,165-257
Classification Level Classification E-value
Superfamily TPR-like 7.59e-28
Family Tetratricopeptide repeat (TPR) 0.0044
Further Details:      
 
Domain Number 2 Region: 304-500
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.5e-27
Family Thioltransferase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART01G07410.1
Sequence length 501
Comment pep:novel chromosome:ABRL00000000:1:5565149:5569582:1 gene:OBART01G07410 transcript:OBART01G07410.1 description:""
Sequence
MRHTPICLTCEKRAEEQRRRRPASRPADPEELKKAGNEQYKKGYFEEALRLYDRALALCP
DNAACRGNRAAALIGLRRIGEAVKECEEAVRIDPSYGRAHQRLASLHIRLGHIEDAQRHL
SLATPQPDLLELHKLQTVEKHLGRCMDARKVGDWKSVLRESDASIAAGADCSAMLFASRA
EALLRLNQLDEADLAISSASKLDYSSSCTSDNKFCGFLANAYLFYVHAQVDMALGRFDHA
VSSVDKARIIDQGNVEVVTMHNNVKAVARARSLGNELFNSGKFSEACLAYGEGLKHHPVN
PVLYCNRAACRFKLGQWEKSIEDCNEALKIQPNYPKALLRRAASYGKMERWAESVKDYEV
LRKELPGDTELAEAYFHAQVALKSSRGEEVSNMKFGGEVEAITGMEQFQMATSLPGVSVI
HFMTPLNQQCCKISPFVNTLCTRYPYINFLKVDISESPAVARAENVRTVPTFKIYKNGTR
VKEMICPSLQLLEYSVRHYGI
Download sequence
Identical sequences A0A0D3EL46
OBART01G07410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]