SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G07750.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G07750.1
Domain Number 1 Region: 417-704
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-80
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 54-140
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000128
Family alpha-D-mannose-specific plant lectins 0.0075
Further Details:      
 
Weak hits

Sequence:  OBART01G07750.1
Domain Number - Region: 313-355
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0902
Family Anti-platelet protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART01G07750.1
Sequence length 743
Comment pep:novel chromosome:ABRL00000000:1:5833969:5836200:-1 gene:OBART01G07750 transcript:OBART01G07750.1 description:""
Sequence
MAGNQTLVSKNGRFELGFFTPGSGIHYFLGVRLRNMAEYSPTFWIGDRVGVIDLPGVSLE
VFGDKLYIKEDGVSLWWSSVAGNGSSSSSDGGAVAVLLDTGDLVVRDQGNLSRVLWRSFD
YPGDSLLPGGRLGLDAATGTNVSLTFKGFSHNGSLQVDASRRNGFVLTTDGIDSRGAFPD
WMVTSQDNGSSLVLNHPDAPNSTEFLQFNLGLISLMRWSDSTAGWVARWTFPSDCKSGAF
FCGDFGACTAGGGGGCECVDGFTPSYPDEWRLGYFVTGCSRSLPLSCEANGQTEHDDSFA
ILDNLRGLPYNAQDEPVTTDEDCRAACLNKCYCVAYSNESGCKLWYHNLYNLSSADKPPY
SKIYVRLGSKLKSNRGLATRWIVLLVVGSLAVTSVMLGLVLLCRYRRDLFASSKFEVEGS
LIVYTYAQIRKATGNFSDKLGEGGFGSVFRGTLPGSTTVVAVKNLKGVGQAEKQFRTEVQ
TVGMIRHTNLVRLLGFCVNGNRRLLVYEYMSNGSLDAHIFSEKSSLLSWHVRYQIALGIA
RGLAYLHEECEDCIIHCDIKPENILLDYEFCPKICDFGMAKLLGREFNSALTTVRGTMGY
LAPEWIYGQPITKKADVYSFGIVLFEIISGRRSTETVKFGSHRYFPTYAAVQMNEGDVLC
LLDSRLEGNANVKELDITCRVACWCIQDEENDRPSMGQVVRMLEGVVDMEMPPIPASFQN
LMESEDSGIYSEESWNFRTRDQF
Download sequence
Identical sequences A0A0D3EL84
OBART01G07750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]