SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G17720.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G17720.1
Domain Number 1 Region: 154-653
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.02e-168
Family Calponin-homology domain, CH-domain 0.00000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART01G17720.1
Sequence length 695
Comment pep:novel chromosome:ABRL00000000:1:15247504:15254043:1 gene:OBART01G17720 transcript:OBART01G17720.1 description:""
Sequence
MGLDGLVVVSDPYLQRRFSQADLRALQAQYAALRDAAPSGRLRLRDLPAALSSAGVGAGK
GGDAEKENSAPAAAQLTEEEWASVLKAVARADERPHQGVGFELFLRVYAEMQLRLKGAAA
GKKAGGGGGGIARSSSSSAAAFLTAATTTLLHTISESEKASYVGHINAYLAEDPFLNTAL
PIDPATDHLFHLTKDGVLLCKLINLAVPGTIDERAINTKKLLNLWEKNENHTLCLNSAKA
IGCTVVNIGTQDLAEGRPHLILGLISQIIKIQLLADVNLKSTPQLVELVEDSKEMEELMS
LSPEKILLRWMNFQLKKGGFQRTVTNFSSDIKDSEAYACLLNVLAPECSAKPSPMSVKDL
LHRARLVLEHADRMGCKRYLTPKDIVDGLPNLNLAFVAHIFQKRNGLSKQMKQVSFVDGL
SDDAQVSREERSFRLWINSLGISTYINNVFEDLRNGWVLLEVIDKIAPGSVNWKMANRPP
IKLPFRKVENCNQVLKIGKELKFSLVNIAGNDIVQGNKKLILAFLWQLMRYNILQLLKNL
RFHSNGKEITDNDILIWANKKVKDSGKHSRMESFKDRSLSSGIFFLNLLGAVEPRVVNWS
LVTKGEKDEEKQMNASYIISVARKLGCSIFLLPEDILEVNQKMMLTLTASIMYWHLKKPT
SFSLDTENGSSCETSSISTSDDSASESSFDDSGAR
Download sequence
Identical sequences A0A0D3EPI9 A0A0D9Y9J9 A0A0E0FM86 A2WQN6 I1R2B6 Q5QMW7
OGLUM01G20580.1 LOC_Os01g33080.1|13101.m03340|protein 39946.BGIOSIBCE002080 39947.LOC_Os01g33080.1 OBART01G17720.1 LOC_Os01g33080.1|PACid:21905257 ONIVA01G19560.1 ORGLA01G0145000.1 ORGLA11G0190800.1 OsIBCD001989 XP_015632792.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]