SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G24290.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G24290.1
Domain Number 1 Region: 475-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-75
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 63-157,189-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-28
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART01G24290.1
Sequence length 795
Comment pep:novel chromosome:ABRL00000000:1:21290138:21293968:1 gene:OBART01G24290 transcript:OBART01G24290.1 description:""
Sequence
MEASLGALIFPCFLLLICARADDTVSRNRPLSGGQRLISSGGLFALGFFQPVVNNSDDRA
PNRWYLAIWYNKISKTTPVWIANRATPISDPNLSQLTASEDGNLALFDQARSLIWATNIT
NNVNSTVGVILDSGNLVLAPASNTSNFLWQSFDEPTNVWLPGAKLGRNKITGQITRFISW
KSSVDPSPGYYTLEIDPNGGDQFIHLWNNSAIYWETGKWIGNMFTGIPEMALYPKEVLSY
KFTVNNQESYFVYRTNASIATAMFIMEISGQVKTVVWMESKKDWVPFLALPKAQCAVYFL
CGSFAMCTENAVTFCSCLRGFSKQYNGEWRYGNPSGGCMRNTKLQYDGNSSSKTTADEFY
ALAVAKLPDKAWGLATGTDGCKQACLNNCSCTAYSYAGGCSLWYGDLINLVAPADGSVGH
SIHIRLAASEFSSSTKTRKATVIGASTAGAILVTLIVIIGILLILRKRNLTEANKVEGSL
VVFRYRFLQHVTKNFSDRLGKGSFGPVFKGTLPDGTLIAVKKLDGVSQGEKQFRAEVSTI
GTIQHVNLIRLLGFCSERSMKMLVYEFMPNGSLDRYLFGSTPLTLSWKTRYQIALGIAKG
LAYLHEKCRSLIIHCDIKPENVLLGADFMPKIADFGLAKLLGRDFSRVLTTMRGTIGYLA
PEWISGTAITTKADVFSYGMMLFEIISGNRNADWHRQGEQGAGTFFPVLVAMRLPEGKIQ
DLLGSELSADANLEEVERACKVACWCIQDDENTRPMMGEIVQILEGLVDVSFPPVPWYLH
VLAQRSNFSTEETSH
Download sequence
Identical sequences A0A0D3ERR0
OBART01G24290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]