SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G25920.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G25920.1
Domain Number 1 Region: 490-786
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-76
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 62-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.29e-26
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  OBART01G25920.1
Domain Number - Region: 339-385
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000231
Family Pan module (APPLE domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART01G25920.1
Sequence length 797
Comment pep:novel chromosome:ABRL00000000:1:22607721:22610114:-1 gene:OBART01G25920 transcript:OBART01G25920.1 description:""
Sequence
MAALLYLTILSSLSFHLCSRASPWRTMTTGSHIRAEDHDKIFLLSPDTTFSCGFYQLGTN
AFTFSIWYTHTTEKTVVWTANPYSPANGGYSPVNLYGSRVSLGHDGNLVLTDTNCTTVWE
SKTSSGKHTTVTLLDTGNLIIKDSSNSTVWQSFDSPTDTLLPWQNLTKNIRLVSRYHHLY
FDNDNVLRLLYDGPEITSIYWPSPDYNAEKNGRTRFNSTRIAFLDDEGNFVSSDGFKIEA
TDSGPRIKRRITIDYDGNFRMYSLNESTGNWTITGQAVIQMCYVHGLCGKNGICDYSGGL
RCRCPPEYVMVDPTDWNKGCEPTFTIDSKRPHEDFMFVKQPHADFYGFDLGSNKSISFEA
CQNICLNSSSCLSFTYKGGDGLCYTKGLLYNGQVYPYFPGDNYMKVPKNSSKSTPSISKQ
QRLTCNLSAPEIMLGSASMYGTKKDNIKWAYFYVFAAILGGLESLVIVTGWYLFFKKHNI
PKSMEDGYKMITNQFRRFTYRELKEATGKFKEELGRGGAGIVYRGVLEDKKIVAVKKLTD
VRQGEEEFWAEVTLIGRINHINLVRMWGFCSEGTNRLLVYEYVENESLDKYLFGERCHER
LLSWSQRYRIALGTARGLAYLHHECLEWVVHCDVKPENILLSRDFDAKIADFGLAKLAKR
DSTSFNFTHMRGTMGYMAPEWALNLPINAKVDVYSYGVVLLEIVTGIRVSSGIVVDERQV
EFPEFVQEAKKIQATGNVTDLVDDRLHGHFDPEQAITMVKVALSCLEERSKRPTMDEILK
ALMLCDDEDDYHPAYSY
Download sequence
Identical sequences A0A0D3ESA2 I1NQI3
OBART01G25920.1 ORGLA01G0212300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]