SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G26020.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G26020.1
Domain Number 1 Region: 472-767
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-70
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 64-200
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-28
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART01G26020.1
Sequence length 772
Comment pep:novel chromosome:ABRL00000000:1:22650795:22653113:-1 gene:OBART01G26020 transcript:OBART01G26020.1 description:""
Sequence
MAKFLYLIILSFFLSLLVFCTSASPRLTLHTGSSFSVEDYKHTFLTSPNSTFSCGFYPIG
TNAFTFSIWLTNTAGKTVVWSANRRSPVNGHGSKVLLHDDGYLVLTDVNGSTVWTSTMSA
GEGSMAALLESGNLVVRDSSGTILWESFTSPTDTLLPTQQLTKDTRLVSGYHSLYFDNDN
SLRLVYNGPEFSSIYWPNDDYTMFRDGIKVKNNSRLAVLDDKGGFFSSDALTVQASDFGL
GIKRRLTLDYDGNLRIYSLDASDGSWTVTWQAIVEMHYVHGMCGKNGICEYLPELRCSCP
PGFEMVDPQNWSKGCRPTFSYNCGKERYKFIEIPQTDFYDFDLGFNQSISFEECQNICLS
TCSCIAFSYRLTGTGVCYPKGLLFNGYKSPAFPGTLYLKVPYSTNLQASSTQSALTCSPG
SQEIATPSDHPRWLYFYIFPGVFGALELIFILTAWWFLSIRNDIQNSAEGGYMMIRNQFR
GFTYQELKEATGKFREELGRGSSGIVYRGVLKDKRVIAVKKLIDVTRGEVEFQAEMSVIG
KINHMNLVRIWGFCSEGKHKLLVYEYVENESLDRYLFNTMGTERLLVWKDRFNIALGAAR
ALAYLHHDCLEWVFHCDVKPENILLTRDFEAKIADFGLSKLYKREGSSFNFSQMRGTMGY
MAPEWATNLPINAKVDVYSYGVVLLEIVAGQRISSHTTREGKVTKLKQFIENVKEALATG
DTKCIVDGRLHGQFNSEQAMVMLIVAVSCLEEERSKRPTMHEVVKSLLDCEE
Download sequence
Identical sequences A0A0D3ESB4
OBART01G26020.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]