SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G33320.8 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G33320.8
Domain Number 1 Region: 1329-1613
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-80
Family Protein kinases, catalytic subunit 0.0000704
Further Details:      
 
Domain Number 2 Region: 2195-2482
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-80
Family Protein kinases, catalytic subunit 0.0000883
Further Details:      
 
Domain Number 3 Region: 517-761
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-62
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 4 Region: 892-1001
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-27
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Domain Number 5 Region: 1743-1853
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.03e-23
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Domain Number 6 Region: 110-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.38e-19
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Weak hits

Sequence:  OBART01G33320.8
Domain Number - Region: 1160-1223
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00141
Family Pan module (APPLE domain) 0.084
Further Details:      
 
Domain Number - Region: 374-430
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0104
Family Anti-platelet protein 0.057
Further Details:      
 
Domain Number - Region: 2024-2086
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0196
Family Hairpin loop containing domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART01G33320.8
Sequence length 2525
Comment pep:novel chromosome:ABRL00000000:1:27959500:27986464:1 gene:OBART01G33320 transcript:OBART01G33320.8 description:""
Sequence
MAPLLVSSSSPRRRRRRRMGWGGGSAASWALKAAMMRTKSSCRKVITLLMIALWLAGCLG
RDSISVNESLSDGRTIVSMKNVFVLGFFSPGASNHRYIGIWHNSLGNKTIIWVGNRNEPL
SDTSGVLMFDSNGNLVIVHGGRSLIVAYGQGAKDMKATILDSGNLVLSSTANSSGYIWQS
FDSPTDTWLPEMKIGLKTTNQTLISWRSNDYPAMGDYKLGMDPAGLSQFIIWWRDNTFWT
SGHWNGDMFSLIPELKFFTTVPISFKCSSNSTNDISCTYSANPSDMLTRIVLNSTGSLSI
MQFDSLAQSWILLWRQPSTCEIPNLCGAFGVCNNNAVPKCNCTGGFVPQNIIAYSNGYTR
EGCIRQTKLQCSSDKFLEIPNVRIPDNRKKMPAVVGPSDCKLACLRNCSCTAYAYSQLEG
CSLWYGDLMNLQDGYDIDGAGTLCLRLAASEVESGGNSGSGHKMLWMAGVIPFVALLSFC
SLSCLLWRRRRQNKGKEDLHAHCSLTTLDMDSAVKLWESEEAGSQFVLFSFSQIAKSTNN
FSAPNKLGEGGFGPVYKGNLPDGQDIAVKRLATNSGQGLIEFKNEVLLIAKLQHVNLVRL
IGCCIQGEEKILIYEYMPNKSLDFFLFEKSRRTALDWAKRIHIIEGIAHGLLYLHKHSRL
RIIHRDLKASNILLDIDMNPKISDFGMARIFGSKETQANTNRVVGTYGYMAPEYAMQGIF
SAWELWKEGRWSELADPSIYNACPEHKESPINRPTMTEIISALDNESTTLPEPKQPAFVS
AGIWTEAGVHGGTHSINGMTISDTQATGPAGSMSTRAPRSLLPLLFVAAAVAFFSRAATA
ADVIGQAGFITGNQTLVSSGGVFELGFFVPNGATDGRRYLGIWYASIPGQTVVWVANRQD
PVVNVPAVARLSADGRLVIVDAKNTTVWSSPAPARNVTAAGATARLQDDGNLVVSSGSPG
SVAWQSFDYPTDTLLPGMKLGVDVKNGITRNMTSWTSSSDPSPGSYTFKLVPGGLPEFFL
FRGPTMIYGSGPWNGAELTGVPDLKSQDFAFTVVSSPDETYYSYSILNPSLLSRFVADAT
AGQVQRFVWINGAWSSFWYYPTDPCDGYAKCGAFGYCDTSTPTLCSCLPGFQPRSPQQWG
LRDASGGCVLTANLTCGAGDGFWTVNRMKLPAATNATVYAGMTLDQCRQVCLGNCSCRAY
AAANVSGGVSRGCVIWAVDLLDMRQYPGVVQDVYIRLAQSEVDALNAAANSEHPSNSAVI
AVVIATISGVLLLGAVGGWWFWRNRLRRRRNETAAAAAGGGDDVLPFRVRNQQLDVKREC
DEKDLDLPLLDLKAIVAATDDFAASNKIGEGGFGPVYMGKLEDGQEVAVKRLSRRSVQGV
VEFKNEVKLIAKLQHRNLVRLLGCCIDDDERMLVYEYMHNQSLDTFIFDEGKRKLLRWSK
RFEIIVGVARGLLYLHEDSRFRIIHRDLKASNVLLDRNMVPKISDFGIARMFGGDQTTAY
TRKVIGTYGYMSPEYAMDGVFSMKSDVYSFGVLVLEIVSGRRNRGFYEAELDLNLLRYSW
LLWKEGRSVDLLDQLLGGSFDYSEVLRCIQVALLCVEVQPRNRPLMSSVVMMLASENATL
PEPNEPGVNIGRHASDTESSETLTVNGVTITEIECRRDQSMIGRFGDKRDMRRRRALALL
VTMAFFSRPVIAVDRIGLTASIIGKSTLESAKGVFKLGFFTPLGGKGTYLGIWYANIQSD
LTVVWVANRQHPVINAPGVVTLSANGLVIVDAQNTTVWSSPVPAGAITAGATARLHDDGN
FAVSSDGSDSQSVVLWQSFDYPTDTLLPGMKLGEDRKKGITRNITSWSSPTDPSPGKYTF
KLVLGGLPEFFLFDNSKTTPIYASGPWNGETLTGVPGLKSQQAKGDFTFTVLSSPEETYY
NYSISNRNPSFLTRFFVDGTEGKLQRIWSSDDGKSWINNKNSYPIDPCDNYGSCGAFGYC
VYTEGQPQQCNCLPGFQSLSAQGSFQDTSKGCARITNLTCGDGDGFWRVNRMKLPDATKA
TVHAGMTLDQCRQECLRNCSCNAYAAAAVSGGVNRGCVIWTVGLMDMRKYPKEFVQDLYI
RLPQSQIDALNAPARRRRLIKNVVIAVVTTICGILGVVGCCCLWRNKMRWKRHSRIGKSS
EAGDIPFRVRKNPASSPARDQWFDENNTSVEDDLDLPLFDLEMIFDATDRFAANNKIGEG
GFGPVYLGRLEDGQEVAVKRLSRRSVQGVVEFKNEVKLIAKLQHRNLVRLLGCCIDDNER
VLVYEYMHNKSLDTFIFDEGNRKLLSWNKRFEIILGIARGLLYLHEDSRFRIIHRDLKAS
NVLLDRNMVPKVSDFGIARMFEGDQTTAYTGKVIGTYGYMSPEYAMDGVFSMKSDVFSFG
VLVLEIVAGRRNRGFCESELNLNLLRYAWMLWKEGKSMNLLDELIGDIFDDIEVLRCIHV
ALLCVEVEPKNRPLMSSVVMMLASENATLPQPNEPGVNIGKITSDTESSHGLTSNSVTIT
TIEAR
Download sequence
Identical sequences A0A0D3EUV0
OBART01G33320.8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]