SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G43220.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G43220.1
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.49e-22
Family Thioltransferase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART01G43220.1
Sequence length 104
Comment pep:novel chromosome:ABRL00000000:1:35013980:35014294:1 gene:OBART01G43220 transcript:OBART01G43220.1 description:""
Sequence
MAERVARLSSQRAVVIFGASNCFMCHVVKTLFSELGVSWAVHEVDKDPNGKDVERALAGM
VGRTPPVPAVFIGGKLVGPTDQVMSLHLAGKLVPLLREAGALWL
Download sequence
Identical sequences A0A0D3EYE5 A0A0D9YJR8 A0A0E0FYH3 A0A0E0N7C6 A2WYT9
OsIBCD037185 39946.BGIOSIBCE004895 OBART01G43220.1 OGLUM01G47520.1 ONIVA01G49150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]