SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART01G44450.2 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G44450.2
Domain Number 1 Region: 110-236
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.51e-25
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART01G44450.2
Sequence length 485
Comment pep:novel chromosome:ABRL00000000:1:35951153:35957773:1 gene:OBART01G44450 transcript:OBART01G44450.2 description:""
Sequence
MRHAALLGVGFALCLLRAQAQPYDYPTAKPSTTWANTDAALRHHVAYTDGSVARAALLRL
NPARLGPSFAFGFFCTNHRAGAPCADFLLGVAVVYCNSGAGITAVTTGIPQVVWSANRAA
PVGDGATAELTADGDLVLRSPGGKVLWSAGAAGRGVSGMSINSDGNLVLFDGSNRTVWQS
FDHPTDTLVVGQSLKQGARLTANASFDNSSEGRIYLAVADDGLAAYVDAKPPQRYYVLGY
SKNAGAYAAYTNGSLAVLDRPGGQQLATVQLPAVAAGTAAGDVLHPYPGDCAYPTVCGAY
GVCTDMQCSCPDAANFRAVDFRRPNRGCVPTSPPAPPATCRSRRARHRLVSLRDTAYFNS
HDTSMRTLERVGEAACKAACLGDCACMAAQFVYGFDPNDGFCYLQSEVLSLETMQPEVFH
YNSSMHIKIAQGSHPVIAWWHSPSPPRLREAPCVSPPAPLLPSPAPSPAFLGCRSNPAPR
RDLRS
Download sequence
Identical sequences A0A0D3EYV7
OBART01G44450.1 OBART01G44450.2 OBART01G44450.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]