SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART02G18840.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART02G18840.1
Domain Number 1 Region: 72-155,223-244
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000588
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Weak hits

Sequence:  OBART02G18840.1
Domain Number - Region: 357-392
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00161
Family Pan module (APPLE domain) 0.087
Further Details:      
 
Domain Number - Region: 221-283
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0169
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART02G18840.1
Sequence length 494
Comment pep:novel chromosome:ABRL00000000:2:17053747:17055378:1 gene:OBART02G18840 transcript:OBART02G18840.1 description:""
Sequence
MEAVRCFVVLCVAVAAALASLGGGFSVAHDRSYSQFEQVLSDPTGVFALGFLRVNSTMLD
LAVVHLPSSFPLWRAIPDRPAQWSAPASLSFDGDLVLTDPAANKVLWSAGAAAGAGGDRV
VLLNTSNLQIQSGGGGGDGGSSPGIVWQSFDAPSETIVQGQNLTSATALYTSDRRFSMRM
GTSYFGLYIEPPASSSGGGGVAAAMYWKHTALQAKAAIVDGGGPTYARVEPDGYLAMYQK
EGPPADVLSFDTFNHGVRALRRMTLEADGNLRAYYWDSTGSRWVLDYTAITDPCGLPSTC
GAYAVCVPPSGRCACLANATDVSGCAAANVGGGGGLCGRTGGEVGGLYWEEFLPFEHSPS
AADCEVRCARNCSCWGAVYSNGTGYCYLMDYPAQMMVAADERKVGYFKVRSLEEAAAASG
GGRAAGVKAALLAVGVTVLVAAAAFGAYRVWKRRCRTAVDARRQVVADDEGLSPGPYKNL
GSFSSVELSSSFRR
Download sequence
Identical sequences A0A0D3F5V9
OBART02G18840.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]