SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART03G10350.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G10350.1
Domain Number 1 Region: 99-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000249
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART03G10350.1
Sequence length 314
Comment pep:novel chromosome:ABRL00000000:3:7135556:7136500:-1 gene:OBART03G10350 transcript:OBART03G10350.1 description:""
Sequence
MGFASCVAVCLAFAVLLPWHATATSPTGTIQRETKQQILASIPPHWQENPVLFLTSPSGK
YTAYFLRSQTAPGAGGLGADFCYVEVLDTSDPGAEGRSVWESECLAVSTVNTCSLVFSWK
GLEVFDGSNSVWHTHDTQSDSQNFLETLELVDEGDMRILDKGGELAWKASDEPRAAQHCG
MPGSPGLASAFPPFAQPIGHGSSDLPFGFGNGDHVAGNGIGGGAVAQPELPVAPVPQPEL
PLAPVPQEADLGGAAGVEPQGQGVGQTSFGFGAQPLVDNSPYDSGAWKQVGGCSLTAIGV
GFILNVAIAMGLGH
Download sequence
Identical sequences A0A0D3FG54 A0A0D9Z4J8 A0A0E0GJN2 A0A0E0NSD0 A2XEH4 I1P9F0 Q10P63
ONIVA03G10970.1 OsIBCD038636 LOC_Os03g14150.1|PACid:21917456 XP_015629153.1.37577 OGLUM03G10110.1 LOC_Os03g14150.1|13103.m01657|protein OBART03G10350.1 39946.BGIOSIBCE010338 39947.LOC_Os03g14150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]