SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART03G21810.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G21810.1
Domain Number 1 Region: 505-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-77
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 61-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-29
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Weak hits

Sequence:  OBART03G21810.1
Domain Number - Region: 340-386
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000785
Family Pan module (APPLE domain) 0.022
Further Details:      
 
Domain Number - Region: 214-283
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00144
Family alpha-D-mannose-specific plant lectins 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART03G21810.1
Sequence length 834
Comment pep:novel chromosome:ABRL00000000:3:16375361:16377865:1 gene:OBART03G21810 transcript:OBART03G21810.1 description:""
Sequence
MAPFFSILPALSFLALLPIVMSRDKIPLKSSLSVDDYQNDVLQSADGTFSCGFLTIYSNA
FAFSIWYTNSKNKTVVWTANRGRPVHAKRSVVTLQKDGAMVLKDYDGTVVWQSDSNSIDV
QYAQLLDTGNLVMKNSSGKVVWQSFDSPTDTLLPTQKITAATKLVSTTGLYVPGHYTFHF
TDSSILSLMYDDADVHEIYWPDPDRGEYGNKRNRYNNTRMGFLDDNGDFVSSDFADQQPF
SASDKGSGIKRRLTLDHDGNLRLYSLSNGEWLVSWVAISQPCNIHGLCGPNGICHYSPTP
TCSCPPGYEMNSHGNWSQGCKAIVDISCSVAKVQFKFVHLPDTDFWGSDQQVVKPVSWQA
CMDICRSDCNCKGFQYLKGEGTCFPKSFLFNGRAYPSHFVSPRNMYLKIPISMNISGMPV
SQSNVLDSRKHSLNCDQMDEKTRELFPDVHKTSQGETRWFYLFGFAGAIFILEVFFIGFA
WFFVSRWDLDALEIQAVEQGYKVMASNFRRYNYKELAKATRKFKCELGRGGSGIVYKGTL
DDGRVVAVKMLENVRQCEEEFQAELRIIGKINHMNLVRIWGFCSENSHRMLVTEYIENGS
LANILFNENILLEWRQRFNIAVGVAKGLAYLHHECLEWVIHCDVKPENILLDGNFEPKIA
DFGLAKLLNRRGSNQNVSRVRGTIGYIAPEWISSLQITAKVDVYSYGVVLLELVSGKRVL
DLATSANEEVHVVLRRLVKMFANNLSGNEPSWIAEFVDCRLSGQFNYTQVRTMITLAVAC
LDEERSKRPTMESIVQLLLLVDESCSSNVLCPEMPTRWTTGHAKANASFCIHSL
Download sequence
Identical sequences A0A0D3FJY4 I1PCD1
OBART03G21810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]