SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART03G27960.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G27960.1
Domain Number 1 Region: 128-387
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 2.1e-42
Family Plant cytotoxins 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART03G27960.1
Sequence length 388
Comment pep:novel chromosome:ABRL00000000:3:23287603:23292425:-1 gene:OBART03G27960 transcript:OBART03G27960.1 description:""
Sequence
MFALEPLVRCRGLPRSPVGEPVAPGGLSAAALVDLAISEPVYASRRCNGNPYGSSRWTET
GMHPRVAAKACMEARRGLKHNRCSTSTSLKEIISTNLLILVVLSYLVHAVSAQSLDEPFR
GTGAEIYEMTYDLKQDQQASFIVSFIDCATKESEFHLGTLKVLRNQTDTDREVPFGWILP
RLIARKGSVTLAFRTDNLYLIGFTDKYGGWYSFNGYKVLIPGSTELEIDGGYGEGGMGGF
RKLGDLPLSRRHALDAVDILWDYDPSTTPKEVLQNATATLLLVIPESARFKEVFEPVIAD
WDSKEGIRLKEKIESMGLLHNWGMLSSVGMIGLPWDSSEVQGYVKKMSRDKVYINSKEDA
VRPLKVLLMSKAMRPKELVIKRINDPQS
Download sequence
Identical sequences A0A0D3FLX9
OBART03G27960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]