SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART04G06920.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G06920.1
Domain Number 1 Region: 537-824
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-79
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 116-193,289-307
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.41e-26
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  OBART04G06920.1
Domain Number - Region: 386-437
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000451
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART04G06920.1
Sequence length 866
Comment pep:novel chromosome:ABRL00000000:4:8575786:8578386:-1 gene:OBART04G06920 transcript:OBART04G06920.1 description:""
Sequence
MCPANLLSFDIAAVAAVVVLMLATAAPAISVQQLYDYPTANLSTRWVNNAAVLQHSVDFT
DGSAVRSIILRSPKTIFGPSFAAGFFCAPPCKAFLFAVFIVYTDSGASITSVRNGIPQVV
WSANRAHPVGENATLELTGDGILVLREADGRLVWSSGTSGRSVAGMQITEQGNLVMFDQR
NVTVWQSFDHPTDALVPGQSLLQGMRLRANTSNTNWTESKLYMTVLSDGLYGYVESTPPQ
LYYEADVRTNKSGKYPTRVTFMNGSLGIFMHTTQAGKPEAIIALPEAKSTQYIRLESDGH
LRLYEWFDAGSNWTMVSDVIQKFPDDCAFPTVCGDYGICTGGQCICPLQANSSSSYFHPI
DERKANLGCAPVTPISCQEMQYHQFLTLTDVSYFDEGQIIANAKNRDDCKEACLKNCSCR
AVMFRYYGQNDSDGECQSVTEVFSLQSIQPEIVHYNSSAYLKVQLTPSSPAPTQNSSSAP
TQTSSFAPTQNKSNKMKAILGSTLAASITLVLVAIIVVYVRRRRKYQETDEELDFDILPG
MPLRFSLEKLRECTEDFSKKIGEGGFGSVFEGKLSEERVAVKRLESARQGKKEFLAEVET
IGSIEHINLVRMIGFCAEKSNRLLVYEYMPGGSLDKWIYYRHNNAPLDWSTRCRIILDIA
KGLCYLHEECRRKIVHLDIKPQNILLDENFNAKLADFGLSKLIDRDHSKVMTVMRGTPGY
LAPEWLTSQITEKVDVYSFGVVLMEIISGRKNIDISQPEEAIQLINLLREKAQNNQLIDM
IDKHSSDMVSHQEEVIQMMKLAIWCLHNDSGRRPSMSTVVKVLEGAMRVENCLDYSFFNA
NSVISVQGNPSTYSAPPHASILSSPR
Download sequence
Identical sequences A0A0D3FTZ3
OBART04G06920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]