SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART04G08900.2 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G08900.2
Domain Number 1 Region: 57-132,160-175
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.28e-18
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART04G08900.2
Sequence length 258
Comment pep:novel chromosome:ABRL00000000:4:10979976:10983231:1 gene:OBART04G08900 transcript:OBART04G08900.2 description:""
Sequence
MACVPVFIFLLLISFCRCDDQLTQGKPLISPNDVLVSKGGIFALGFFSPGSSNTSLFLGI
WYYNIPERTYVWVANHDNPITTPSSAMLAISNSSNLALSDSRGHTLDDDDRKLVLQLPDN
TTIWQSFDHPTDTVLPNIKFLVSQKTQVQMRLVALKSPDDPSTVVNTEDEFYVMYTTSDA
SPYARITLDYNGDMKSLSWNSSLSSWAFFPHKPMAVANDCDHSATATSRWPSRDASASMG
SSQLTALILGEDAGESNS
Download sequence
Identical sequences A0A0D3FUM7
OBART04G08900.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]