SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART04G15940.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G15940.1
Domain Number 1 Region: 493-783
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-73
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 59-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000288
Family alpha-D-mannose-specific plant lectins 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART04G15940.1
Sequence length 803
Comment pep:novel chromosome:ABRL00000000:4:17071001:17073412:1 gene:OBART04G15940 transcript:OBART04G15940.1 description:""
Sequence
MMEPLLTLLVLLLVFAIAPSKARNITLGSLLTTEGVNTSWISPSGDFAFGFQLISTNTYL
LAVWFDKTVDKSIAWYAKTNTQVPEVVLVPSGSQLQLSSNGLSLLDPGGHELWNPQVPGA
AYANMLDTGNFVLLGADGSTKWGTFDSPADTILPTQGPFSEVQLYSRLTQAAYSNGRFLL
QVKDGNLEFDLVAVPSGNKYRSYLTPNTGGNGSQLLFNETGGVYFTLKDGTEITITSTIM
GSMVNYYQRATLDPDGVFRQYVYPKKEAVTRGWKYIGWTAVDFIPRNICDVFTTSDGSGA
CGFNSYCSFNWNQNETVECQCPPHYSFIDEARKYKGCKANFQQQSCDLDEATMIDEFDLI
PMKGIDWPSADYESFTSVGMDDCQKLCLTDCFCAVTVFNEGNCWKKKLPMSNGRMDSSVD
RTLYLKVPKNNNSLSIINPGSIKWKKDKKYWILGSCLLLGSFLLVLILLISFILFGHYFA
KKSKKIDPPKQSYSTGGLPLKSFTYEDLHEATGGFCEEIGSGGSGVVYKGTLQDQLGTHI
AVKKINKVLPDIEKEFAVEVQTIGWTFHKNLVRLLGFCNEGAERLLVYEFMPNGPLNEFI
FCTIRPSWYQRVQFALGVARGLLYLHEECSTQIIHCDIKPQNILLDNNLTAKISDFGLAK
LLQMDQTQTTTGIRGTRGYVAPEWFKNIAVTAKVDVYSFGVILLEIVCCRRNVEQDIIDE
DRAILTDWANDCYRSGRIDLLVEGDEEASFDIKRVQRFLAVALWCIQEDPAMRPTMHKVT
QMLDGAVEIAVPPDPASYISSLQ
Download sequence
Identical sequences A0A0D3FX06 I1PM73
OBART04G15940.1 ORGLA04G0129200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]