SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART04G24880.3 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G24880.3
Domain Number 1 Region: 535-852
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-81
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 3390-3692
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-77
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 3 Region: 1639-1909
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-68
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 4 Region: 1263-1375,1405-1526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-64
Family Protein kinases, catalytic subunit 0.00039
Further Details:      
 
Domain Number 5 Region: 2659-2910
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-58
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 6 Region: 4222-4404
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-44
Family Protein kinases, catalytic subunit 0.0009
Further Details:      
 
Domain Number 7 Region: 109-200,232-258
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-31
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Domain Number 8 Region: 2220-2312,2344-2369
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.55e-29
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Domain Number 9 Region: 2999-3088,3120-3143
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.03e-27
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Domain Number 10 Region: 1957-2135
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.32e-26
Family Protein kinases, catalytic subunit 0.0047
Further Details:      
 
Domain Number 11 Region: 3831-3914,3949-3980
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-19
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  OBART04G24880.3
Domain Number - Region: 2502-2566
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000275
Family Anti-platelet protein 0.031
Further Details:      
 
Domain Number - Region: 387-429
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0012
Family Anti-platelet protein 0.043
Further Details:      
 
Domain Number - Region: 940-1003
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00196
Family alpha-D-mannose-specific plant lectins 0.036
Further Details:      
 
Domain Number - Region: 3282-3320
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00824
Family Hairpin loop containing domain 0.041
Further Details:      
 
Domain Number - Region: 4102-4142
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00824
Family Anti-platelet protein 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART04G24880.3
Sequence length 4430
Comment pep:novel chromosome:ABRL00000000:4:23442909:23476043:-1 gene:OBART04G24880 transcript:OBART04G24880.3 description:""
Sequence
MTQIINVPRSTLRSFWSSGLFGNNVNAKIFQSESNTPLESGVVLFWPGSFAVPGKSSCLA
CPKKKNKGQMNMAYLPVNRLISPSGKLVSKSGVFALGFFSPATSNQSLFLGIWYNNIPER
TYVWVANRDNPITTPSSAMLAISNSSDLVLSDSKGRTVWTTMANVTGGDGAYAVLLDSGN
LVLRLSNNATIWQSFDHPTDTILSNMKILLRYKEQVGMRLVAWKGLDDPTTGDFSCSGDP
SSDLQVFVWHGTKPYYRSIVLDSVWVSGKAYGSSTSFMYQTYVNTQDEFYVIYTTSDGSP
YMRIMLDYTGTFRLLSWNVNSSSWAIYSQRPAAIGDCDPYGSCGPFGYCDFTSVIPRCQC
PDGFEPNGSNSSSGCRRKQQLRCGEGNHFMTMPGMKLPDKFFYVQDRSFEECAAECSRNC
SCTAYAYTNLTITGSPGTTASQSRCLLWVGELVDMARNNLGDNLYLRLADSPGHKKSRYV
VKVVVPIIACVLMLTCIYLVWKWQSKGEKRNNENQNRAMLGNFRASHEVYEQNQEFPCIN
FEDVVTATNNFSDSNMLGEGGFGKVYKGKLGGGKEVAVKRLSTGSTQGLEHFTNEVVLIA
KLQHKNLVRLLGCCIHGDEKLLIYEYLPNKSLDHFLFDPASKFILDWPTRFKIIKGVARG
LLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQQEANTNRVVGTYGYM
SPEYAMDGVFSVKSDIYSFGVILLEIVSGLKISLPQLMDFPNLLAYAWRLWKDDKTMDLV
DSSIAESCSKNEVLLCIHIGLLCVQDNPNSRPLMSSVVFMLENEQAALPAPIQPVYFAHR
ASETKQTGENTNSSNNNMSLTEMQGKKESTVMEAATTNIFYRPVIFFSVLLCFQYRAAGV
ASDTLSNGRNLTDGDTLVSANGSFTLGFFSPGLPSRRYLAIWFSESADAVWVANRDSPLN
DTAGVVVIDGTGGLSFDHPSNTLIAGMRLGRNPRTGVPEMASYSSMWWSSLTEIAYIFTA
AAPFSRLVLSEAGVIQRLVWDPSSKGWNTFAQAPRDVCDDYAKCGAFGLCNVNTASTLFC
SCMAGFSPMFPSQWSMRETSGGCRRNAPLECGNGSTTDGFVPVRGVKLPDTDNATVDTGA
TLDECRARCFANCSCVAYAAADIRGAGGGSGCVMWTGDVIDVRYVDKGQDLYLRLAKPEL
VNNKKRTVIKVLLPVTAACLLLLMSMFLVWLRKCRGKRQNKVVQKRMLGYLSALNELGDE
NLELPFVSFGDIAAATNNFSDDNMLGQGGFGKGMLGDNKEVAIKRLSKGSGQGVEEFRNE
VVLIAKLQHRNLVKLLGCCIHGDEKLLIYEYLPNKSLEAFIFGTVQKHTMRSNKLHSMLT
DREILLFLRKYLKIPKFYTKIFGTLRYLVSEDPASKYALDWPTRFKIIKGVARGLLYLHQ
DSRLTIIHRDLKSSNILLDVDMSPKISDFGMARIFGGNQQEANTNRVVGTYGYMSPEYAM
DGAFSVKSDTYSYGVILLEIVSGLKISLPRLMDFPNLLAYAWSLWKDDKAMDLVDSSIAE
SCSKMEVLLFNNKKRTVVKIMLPLTAACLLLLMSIFLVWLYKCRVLSGKRHQNKVVQKRG
ILGYLSASNELGDENLELPFVSFGEIAAATNNFSDDNMLGQGGFGKVYKGMLDDGKEVAI
KRLSKGSGQGAEEFRNEVVLIAKLQHRNLVRLLDHANKYVLDWPTRFKIIKGVARGLLYL
HQDSRLTVIHRDLKPSNILLDVDMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEY
AMDGAFSVKSDTYSFGVILLEIISLPRLTDFPNLLAYAWNLWKNDRAMDLMDSSISKSCS
PTEVLLCIQIGLLCVQDNPNNRPLMSSVVSMLENETTTLSAPIQPVYFAHRAFEGRQTGE
NSISLLEGRTKLGLPPIGGKPLPCLLDFVPTNLGMLGGNKEVAIKRLSKHSGQGVEEFRN
EVVLIAKLQHKNLVRLLGCCIHGEEKLLIYEYLPNKSLDYFLFGIFSVKSDTYSFGVLVL
ELISGSKISSPHLIMGFQNLIACAWSLWKNGKAEDLVDSIILQIYSLNEFLLCIHVGLLC
VQEDPNARPLMSSVVAMLENEATTLPTPKQPAYFVPRNCIAGGAREDANKSKSLGHSLLR
CFLWSNRVLLKSQESRLRRIMCDDQLTQAKKLYPGDVLVSQNGVFALGFFSPATSNQSLF
LGIWYNNIPERTYVWIANRDKPITAPSSAMLAISNSSNFVLSDLEGHTFWTTMANINTRG
DRAYAVLLDSGNLVLRLPDNTTAWQSFDHPTDTLLPNMKFFLRYKAQVAMRLVAWKGPND
PSTGDFSYHSDPRSNLQAFIWHGTKPYYRFIALSLNRVLVSGEAYGSNIATLMYKSLVNT
GDELYIMYTTSDGSPYTRIKLDYMGNMRFLSWNGSSSSWTVISQQPAAAGDCNLYASCGP
FGYCDFTLAIPRCQCLDGFEPSDFNSSRGCRRKQQLGCGGRNHFVTMSGMKLPDKFLQVQ
NRSFEECMAKCSHNCSCMAYAYAYGNLTKADTMSDQSRCLLWTGDLADMARASLGDNLYL
RLADSPGHTSEDKKKNRYLVVVLVTIIPCLLMLTCIYLVRKWQSKASVLLGKRRNNKNQN
RMLLGNLRSQELIEQNLEFSHVNFEYVVAATNNFSDSNILGKGGFGKVYKGKLEGGREVA
VKRLNTGRTQGIEHFTNEVVLIAKLQHKNLVRLLGCCIHGDEKLLIFEYLRNKSLDYFLF
DDSKKPILDWQTRFNIIKGVARGLVYLHQDSRMRVIHRDLKASNILLDEEMSPKISDFGM
ARIFGGNQHQANTKHAWSLWKDGKAEEFVDSIILECYSLNEFLLCIHVGLLCVQEDPNAR
PLMSSVVAMFENEATTLPTSKQPAYFVPRNCMAEGAREDANKSVNSISLTTLQGPNEAES
LTGNMVYFLMFLLLLSIPLCKTDDQLTLGKPIFPSEMLISKGGIFALGFFSPANFSNSLY
VGVWFHNIPQRTVVWVANRDNPITTPSSATLAITNSSGMVLSDSQGHILWTTKISITGAS
AVLLDTGNFVLRSPNGTDIWQSFDHPTDTILAGMMFLMSYKSEIVGRLTAWRSHDDPSTG
DFSFSLDPSSDLQGMTWNGTKPYCRNGVRTSVTVSGAQYPSNSSLFMYQTLIDSGNELYY
SYTVSDSSMYTRLTLDSTGTMMFLSWDNSSSSWMLIFQRPAAGSCEIYGSCGPFGYCDFT
GAVPACRCLDGFEPVDPSISQSGCRRKEELRCGEGGHRFVSLPDMKVPDKFLQIRNRSFD
QCAAECSSNCSCKAYAYANLSSGSTMADPSRCLVWIGELVDSEKKASLGENLYLRLAEPP
GKQNKEIQKRLMLEYPGTSNELGGENVKFPFISFGDIVAATDNFCESNLLGRGGFGKVYK
RFPIYIDDNMKGILEGGTEVAVKRLNEGSGQGIEEFRNEVVLIAKLQHRNLVRLLGCCIH
EDEKLLIYEYLPNKSLDAFLFDATRKYVLDWPTRFKIIKGIAKGLLYLHQDSRLTIIHRD
LKASNILLDTEMNPKISDFGIARIFHGNQQQANTTRVVGTYGYMSPEYVLGGAFSVKSDT
YSFGVLLLEIVSGLKISSSKLTPNFFSLTAYAWRLWKDGNATELLDKCIHVGLLCVQDHP
NDRPSMSSVVFMLENESTLLPAPKQPVYFEMKNHGTQEATEETGCGGGGAGTCPDGRRYS
AVHRLNRALPLLGCNASATSPSSTGSGRPRTPGASTCGADRRRLTAPHRRQPPLRRRIIF
MFLISFCQSDDRLTPAKPLIFPGGDKLISDGGVFALGFFSLTTTNSTPSLLYLGIWYNNI
PERTYVWVANRDNPITTHTARLAVTNTSGLVLSDSKGRTIWTTANTVTIGGGGATAVLQN
TGNFVLRLPDHPTDTILPGLPGFKLWTNYKNHEAVRVVAWRGRRDPSTCEFSLSGDPDQW
GLQIVIWHGASPSWRSGVWNGATATGLTRYIWSQIVDNGEEIYAIYNAADGILTHWKLDY
TGNVSFRAWNNVSSTWTSPFERPGHGCLHYGACGPFGYCDITGSFQECKCLDGFEPADGF
SLNSSRGCRRKEELRCGGQDHFFTLPGMKVPDKFLYIRNRTFEECADECDRNCSCTAYAY
ANLRTILTTGDPSRCLVWMGELLDSEKAGAVGENLYLRLAGSPAVNNKNIVKIVLPAIAC
LLILTACSCVVLCKCESRDAKRKSVLDWTTRFMIIKGIARRLLYLHQDSRLTIIHRDLKA
SNILLDTNMSPKISDFGMARIFEGNKQQENTTRVVGTYGYMSPEYALEGSFSVKSDTYSF
GVLLLELAWSLWKDGNAMDLVDSSIRESCLLHEFLRCIQIALSCVQDDPTARPLMSSIVF
MLENETAALPTPKEPAYLTAMVYGTKDTRENKERSVNNVSITALEGHGSI
Download sequence
Identical sequences A0A0D3G013
OBART04G24880.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]