SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART04G24910.2 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G24910.2
Domain Number 1 Region: 501-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-75
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 62-157,189-214
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.2e-28
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 
Weak hits

Sequence:  OBART04G24910.2
Domain Number - Region: 355-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00173
Family Hairpin loop containing domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART04G24910.2
Sequence length 786
Comment pep:novel chromosome:ABRL00000000:4:23481398:23484983:1 gene:OBART04G24910 transcript:OBART04G24910.2 description:""
Sequence
MACLSHNLPVFIHLLLLISFCRCDDQLRHAKRLISPSDMLISKGGDFALGFFSPATSNQS
LFLGIWYHNISERTYVWVANRDDPIAASSSATLSISNNSALVLSDSKGRTLWTTMASPNS
IVTEDDGVYAVLLDSGNLVLRLSNNTTIWQSFDQPTDTILPNMKFLVRSYGQVAMRFIAW
KGPDDPSTGDFSFSGDPTSNFQIFIWHETRPYYRFILFDSVSVSGATYLHNSTSFVYETV
VNTKDEFYLKYTISDDSPYTRVMIDYMGNFRFMSWNSSLSSWTVANQLPRAPGCDTYGSC
GPFGYCDLTSAVPSCQCLDGFEPVGSNSSSGCRRKQQLRCGDDHFVIMSRMKVPDKFLHV
QNRNFDECTDECTRNCSCTAYAYTNLTATGTMSNQPRCLLWTGELADAWRDIRDTIAENL
YLRLADSTGSNSTVNRKKKRHMVVNIVLPAIVCLLILTACIYLVSKCKSRGIRQNKEKTK
RPVIQQLSTIHDLWDQNLEFPCISFEDITAATDSFHDTNMLGKGGFGKVYKGTLEDGKEI
AVKRLSKCSEQGMEQFRNELVLIAKLQHKNLVRLLGCCIHGDEKLLIYEYLPNKSLDKFL
FNHTTEATLDWLTRFNIIKGVARGLLYLHQDSRMKIIHRDLKASNILLDGEMNPKISDFG
MARIFGGNEQQESTRRVVGTYGYMSPEYAMEGTFSVKSDTYSFGILLLEIDSPNARPLMS
FVVSMLENEDMPHPIPTQPIYFVQRHYESEEPREYSDKSVNNAELIYVQKLNRYSSNRIM
IRDPHK
Download sequence
Identical sequences A0A0D3G017
OBART04G24910.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]