SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART05G04610.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART05G04610.1
Domain Number 1 Region: 494-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.53e-76
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 69-166,198-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.95e-25
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 3 Region: 366-423
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000863
Family Pan module (APPLE domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART05G04610.1
Sequence length 814
Comment pep:novel chromosome:ABRL00000000:5:3416231:3418675:-1 gene:OBART05G04610 transcript:OBART05G04610.1 description:""
Sequence
MTTLLYISLGFLLFSLHVTPPCSAATNDTLAAGEVLAVGDKLVSRNGRFTLGFFQPSVVV
KSGNITSPNWYVGIWFSNISVFTTVWVANRDSPVTELQLNQTQLKLSKDGNLVISSNASI
IWSSTVNRTSATTMNSNTSVVLSNDGNLVIGSSPNVLWQSFDYPSDVLLPGAKFGWNKVT
GFTRRFTSKKNLIDPGLGLYYVELDNTGIDLSRSNPPNMYWSWSSEKSSRALISLLNQLI
NINPETKSRINMTYVNNNEEEYYEYILLDESYYAYVLLDISGQIEINVWSQDTQSWKQVY
AQPADPCTAYATCGPFTICNGIAHPFCDCMESFSQKSPRDWELDNRTAGCSRNTLLDCSN
TTSSTDVFHTIARVRLPYNPQIVDNATTQSKCAQACLSYCSCNAYSYENSKCSIWHGDLL
SVNRNDGIDNSSEDVLYLRLAAKDVPSSRKNKIKPIVAVVAASIVSLLVMLMLILLVLRK
KLRFCGAQLDDSQCSGGIVAFRYNDLCHATKNFSEKLGGGGFGSVFKGVLSDSTIIAVKK
LDGARQGEKQFRAEVSSIGLIQHINLVKLIGFCCEGDERLLVYEHMVNGSLDAQLFQSKA
TVLNWTTRYNLAIGVARGLSYLHQSCNECIIHCDIKPENILLDASFAPKIADFGMAAFVG
RNFSRVLTTFRGTVGYLAPEWISGVAITPKVDVYSFGMVLLEILSGRRNSYKVHTDDNSD
QVAFFPVQAISKLHEGDVQSLVDPQLNGDFSLVEVEKVCKVACWCIQENEIDRPTMNEVV
RVLEGLQELDMPPMPRLLAALAECTVVAHCDDDS
Download sequence
Identical sequences A0A0D3G3N6 I1PSS6
ORGLA05G0042400.1 OBART05G04610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]