SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART06G04380.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART06G04380.1
Domain Number 1 Region: 514-813
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-70
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 75-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.71e-30
Family alpha-D-mannose-specific plant lectins 0.0019
Further Details:      
 
Weak hits

Sequence:  OBART06G04380.1
Domain Number - Region: 376-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0122
Family Anti-platelet protein 0.051
Further Details:      
 
Domain Number - Region: 232-279
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0157
Family Terpenoid cyclase N-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART06G04380.1
Sequence length 818
Comment pep:novel chromosome:ABRL00000000:6:2936247:2938703:-1 gene:OBART06G04380 transcript:OBART06G04380.1 description:""
Sequence
MRGVYIFTTIFFLLMPTIALANHRKPFLARRSFISTQAFIARRSSISTQDDTTTILVSPN
GDFSCGFYRVATNAFTFSIWFSRSSEKTVAWTANRDAPVNGKGSRLTFQKDGTLALLDYN
GKVVWSTNTTATRADRAELLNNGNLVVMDPEGQHLWRSFDSPTDTLLPLQPITRNVKLVS
ASARGLLYSGFYNFLFDSNNILTLVYNGPDTASIYWPNPSFDQPWKNGRTTYDSLRYGVL
NQTGYFVSSDLFKFEASDLGDHVMRRLTLDYDGNLRLYSLNETSGNWSVSWMAFSRVCQM
HGVCGTNAVCNYIPELHCSCLQGFEVIDPTDWSKGCKRKVDITAIWDKGNRHNITNNSTS
QDFSIRKITATDFWGYDTAYTQLIPYSNCRNMCLTANNCQAFGYRKGTGECYPKYSLFNG
RRFPDPYNDLYLKVPKGVPFREESDSRPTHSCGVTEKLAYPSSQMFEEVTSNFEFGYFLS
SVLTLLLIEVVLIIVGFSVVRKWETRPEITDEGYAIISSQFRRFSYKELQKATNCFQEEL
GSGGSGVVYKGVLDDERKVAVKILNDVIYGEQELRSELSVIGRIYHMNLVRIWGFCVEKT
KRLLVSEYSENGSLDRLLFDYHNLFPVLKWSQRYNIALGVAKGLAYLHHECLEWIVHCDI
KPENILLDKDFEPKIADFGLVKLLKPEAAQMPSRVHGTRGYIAPEWALNLPITGKADVYS
YGVVLLELVKGSRVSRWVVDGKEEVGLAVKRNVDTLREKLASEDQSWLLEFVDSRLDGEF
NYSQVATVLKIAVLCLEEDRRMRPSMDTVVEVLLSLVE
Download sequence
Identical sequences A0A0D3GD81
OBART06G04380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]