SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART08G02100.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART08G02100.1
Domain Number 1 Region: 71-217
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.00000000000000563
Family Shiga toxin, A-chain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART08G02100.1
Sequence length 339
Comment pep:novel chromosome:ABRL00000000:8:1485884:1487662:1 gene:OBART08G02100 transcript:OBART08G02100.1 description:""
Sequence
MPPTKKDKGKEKIKEPKPSDDFYLDLGDLPKSYANLMKDIPRRLEEIIKAEAPSTSKGKK
LFKKISGKLYTAQSGTFLVHLTPDKDTADSGRVSLLFRWKDLYFEGFYSKGIWFRLQDFQ
AELPPQSQLPYAAKGGKGVVILSIESNYAGIGGNTIYMGSDAFDKCLKAMLRAPDLEGHR
LYSVLKSNRVLAVPVVGISEPLRFPQFQEWVLSTLSPPPTDADHSSSSDDPSPGTDAAES
YSAGMGTGRDKKVPEKFSFYFTKWGTLSEGLLNNSVPEEFSTMSIDEMAALLGILRWMEG
MSLPAPRSGTHDIEASSSRASRATKGKHNTSKAPFESQE
Download sequence
Identical sequences A0A0D3GW29
OBART08G02100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]