SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART08G06870.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART08G06870.1
Domain Number 1 Region: 127-228
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000687
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  OBART08G06870.1
Domain Number - Region: 251-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0829
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART08G06870.1
Sequence length 457
Comment pep:novel chromosome:ABRL00000000:8:6046883:6048391:1 gene:OBART08G06870 transcript:OBART08G06870.1 description:""
Sequence
MPPYIIPLCLILFIIQASHSMGAQINETTIPQGSEINTAGPQSWVSPSGRFAFGFYPEGE
GFSIGVWLVTDPSRFIXWTAFRNDPPVSGGSILLTAGGSLQWIPPNQGFQGKNLPPGNQL
FSSVSNTNHATGKYRLSNQPDGNLVMYPIGTIDPDSAYWNTGTYAQNFLLTLTLDPNGTL
WLFDRNSPYRMVLFLTNQSLSASPDSESYYHLTLDADGILRLYSHVFFKQGGAPKTKVEW
LVPPSNDRCNVKGVCGPNSFCQVTSSGETSCSCLPGFEFLSANQSTQGCWRAQTGGCTRN
SPNGDIGLVATMVTVKNTSWSDRSYNIPPQSPTIEECKAICISDCACEIAMFDSYCSKQM
LPIRYGKRVPGSNTTLFVKVYSYEPKRTASATSTAMLTSGAALAMLSLVLLSVSVMLCKR
RPFLRYTRAAQHHETEFDENIGIRPYSFHDLELSTDC
Download sequence
Identical sequences A0A0D3GXP9
OBART08G06870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]