SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART09G09660.3 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART09G09660.3
Domain Number 1 Region: 163-297
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.42e-31
Family Thioltransferase 0.00034
Further Details:      
 
Domain Number 2 Region: 46-134
Classification Level Classification E-value
Superfamily TPR-like 2.07e-22
Family Tetratricopeptide repeat (TPR) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART09G09660.3
Sequence length 300
Comment pep:novel chromosome:ABRL00000000:9:11014626:11017074:-1 gene:OBART09G09660 transcript:OBART09G09660.3 description:""
Sequence
MATAGASSFEDEIMESDIELEGEAVEPDNDPPQKMGDPSVEVSDEKRKLDEAIEHLTEAI
VLNPTSAIAYATRAVIFVKSKKPNAAIRDADAALKINPDSAKGYKSRGMAKAMLGKWEEA
AQDLRMAAKLDYDEEIGAELKKVEPNVLKIEEHRKKYERLRKERDIKKAEMEKQRKHAEE
VSAASAALKDGDVIAIHSSSELDAKLKAASSLSRLVVLYFTAAWCGPCRFIGPVCKSLAE
KHRNVVFLKVDIDELNSVAYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQHGSS
Download sequence
Identical sequences A0A0D3H6N3
OBART09G09660.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]