SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART10G15130.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART10G15130.1
Domain Number 1 Region: 63-173,665-720
Classification Level Classification E-value
Superfamily TPR-like 6.88e-24
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 2 Region: 209-265,461-548
Classification Level Classification E-value
Superfamily SET domain 5.33e-17
Family Histone lysine methyltransferases 0.086
Further Details:      
 
Weak hits

Sequence:  OBART10G15130.1
Domain Number - Region: 255-294
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000349
Family MYND zinc finger 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART10G15130.1
Sequence length 793
Comment pep:novel chromosome:ABRL00000000:10:15911866:15916919:-1 gene:OBART10G15130 transcript:OBART10G15130.1 description:""
Sequence
MERLKSAVPAELRRAVGEGTAANLPSTTSRLLAFLEAIPLFRQVIGELTDPELALCRKDK
GRAAELKGKGNACFSKREFEQALGFYSQALRYFPISPDGTDASLIATLYVNRASTMHKLG
LLEECLRDCDRAISVSPNYAKAWYRRGMVNASFRNYSSSIHDLEVALSMEVTSSGKSNIE
QELKLILQKHQNVNEVGTSSSNCINADMPHTEQQPKVILECTSTPNKGRGMSFPNDISPA
SLIHAEDPLAVIIMKSCRDTHCHYCFSEAPADVVVCPSCTIPIYCSNRCQEKAIGQMSCN
QNTHPESNNNVVDIAKLCVTSTKSKTPDSKQIAEHRHECGGARWAAVLPADIVLAGRIMA
QYIEKQLLVGKRSTISGPNLDLVHHYDQDSSASKFESHIYATVLFLCLQSYYKSGVSWAE
DSLSQLVLLICQIKVNSIAIVHMKSMDGGKALTKGFSGFSGDVMCSVEQVRVAQAIYMSG
SFFNHSCRPNIHAYFHSRTLILRSTEYIKAGSPIELSYGPQVGEMDLPERQKSLQENYYF
SCGCSSCSVLSLSDLVMNSFCCPQSNCLGAVSELIHHRHKENFVHVSIGESHVCTLSLPD
VSKFDEDIVKVGKLFFKSDTMFNIDPGFCMSCRSQLDLSSAVAMSDRATSKINRLKELPS
LDNVPEVLIAEALQSLERIEKLRHPYSKTLAQSHDTIAEAFAKVGDQEQARKHCEASIKI
LEKLYHPRHIIIAHELIKLVSIELSMGDGASAAAAFARADAIFSLYYGPDVERILPYVDV
LRRTVSERSIDSC
Download sequence
Identical sequences A0A0D3HFF7
OBART10G15130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]