SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART11G07910.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART11G07910.1
Domain Number 1 Region: 123-264
Classification Level Classification E-value
Superfamily At5g01610-like 2.88e-34
Family At5g01610-like 0.001
Further Details:      
 
Domain Number 2 Region: 289-444
Classification Level Classification E-value
Superfamily At5g01610-like 2.09e-33
Family At5g01610-like 0.0044
Further Details:      
 
Domain Number 3 Region: 1-110
Classification Level Classification E-value
Superfamily At5g01610-like 6.54e-32
Family At5g01610-like 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART11G07910.1
Sequence length 456
Comment pep:novel chromosome:ABRL00000000:11:6442005:6455111:-1 gene:OBART11G07910 transcript:OBART11G07910.1 description:""
Sequence
MLGKYGFPPGILPAGAQGYTLDAGDGSFQVTLPGDCVVDVQGYKLRYRSNIYGNVRAGSI
DGLDGVSVKIAIVWVGIHDVEADGGDVTFHAGAISKSSPADGFQTSPSCHTNMAKLIFLL
AMVAFASTLLVSIAGAADNSTSPSSPSADPTAYDMLQRFGFPVGILPQGVQGYKLGDDGS
SFEVYLAGDCEFRAAKKYVLHYSSRVAGQIAAGSITSLEGVKVKEAFAWFLISEVDVDGD
QIKLHVGLYTATVAADQLAVSPHKSNQLRHFVTVTGATMAKKLLAAAAALLLLLAAAAPA
LASSSSSPGSTNLTATPTAYEMVERYGFPRGILPEGVESYVLRPDGSFEVRLSGDGNGGG
DCEFRVGDGGAYLLRYGRRVAGVAMEGSIRSLEGVSVKVLFAWLGIGRVDRAGDDLRFFV
GPLSAAFPLANFADCPRCRCGFDCDTAAAADVIAAS
Download sequence
Identical sequences A0A0D3HK00
OBART11G07910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]