SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART11G09050.2 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART11G09050.2
Domain Number 1 Region: 223-361
Classification Level Classification E-value
Superfamily ApaG-like 1.7e-29
Family ApaG-like 0.00028
Further Details:      
 
Domain Number 2 Region: 13-147
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000196
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART11G09050.2
Sequence length 361
Comment pep:novel chromosome:ABRL00000000:11:7647787:7649417:-1 gene:OBART11G09050 transcript:OBART11G09050.2 description:""
Sequence
MYPLPLVRRVKIFWSSLKSWLSENFPEALKTLNKGVSEAQIQSAEDDLGFKLPLPTKLLY
RFCNGQLPLSEHHRENMRMAHLGIIGGYVFYDHLINVHLSPLEQIVEETKEFYREFYDQG
VFNMTNLIIVATSWYRPKTFFLNCSDDQLYVGTINLQDGEMLPCVPKSLIRPTNTDMPQD
GLLLWLEEHLRRLQNGMIKIRMLKTSRYISLFPEASPSCTSAMTNGVKVRASAVFAPEHP
ESRRPGAKCLYAYSIRLSVPEACMLGGVYYSSCQLYSRHWIIRWRDRVVSDVNGEGVIGK
YPLLTPGQEEFVYESCTPLPDSPGSVEGSFTFVPGKLSRPEGKPFEVTVAPFPLEIPEYI
F
Download sequence
Identical sequences A0A0D3HKD7
OBART11G09050.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]