SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART11G17110.2 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART11G17110.2
Domain Number 1 Region: 102-209
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.000000000196
Family Plant cytotoxins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART11G17110.2
Sequence length 241
Comment pep:novel chromosome:ABRL00000000:11:17114505:17119216:1 gene:OBART11G17110 transcript:OBART11G17110.2 description:""
Sequence
MAAAPAPALAPDAAALQLQVLHPLVLGSECRAYAYMHMHMLEGVGPLGAWIRMWFGYSPQ
LVFLLICIRNSWLYRKVLSPDLWFTQNELVCHDVEYFTRKAIRTFIIDIEHVGDRTYHTL
MRSIHEYNLQNSPFTCLNAAVTPAGGYHMILLYKGQKSVRLLFRDSDGYLVAVEDDLGSW
YRFKDIPELPFINSAEMKMESGYGDMETSEWFVSKRFKVFMDLEFPSDLWKLVHNWGLVS
N
Download sequence
Identical sequences A0A0D3HN25
OBART11G17110.2 OBART11G17110.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]