SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART12G01840.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART12G01840.1
Domain Number 1 Region: 199-499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-74
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 2100-2397
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-74
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 3 Region: 1095-1360
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-61
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 4 Region: 650-923
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-57
Family Protein kinases, catalytic subunit 0.00061
Further Details:      
 
Domain Number 5 Region: 1649-1793
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-24
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  OBART12G01840.1
Domain Number - Region: 1938-1989
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Anti-platelet protein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART12G01840.1
Sequence length 2408
Comment pep:novel chromosome:ABRL00000000:12:1228671:1260957:1 gene:OBART12G01840 transcript:OBART12G01840.1 description:""
Sequence
MLRDCQGCRPTFRLECGRPAKLVALPHSDFWGYDLNDGEVMPLGDCANKCLDNCACVVFQ
YKEHMECYLKSVLFNGKTFPGLPGTVYIKVPADFDVPEFHVHQWQRGGDGGGGGLAIQED
IAGCAAAATGDSNRKVLLNVSSSLSSHDAGKPVWPYLYGFLSALLVVEAIVIGFGCWLFS
SKGLFRHSRVYAIDQEGYKLITSHFQRYTYADIKKATANFTGVIGRGGSGVVYKGVPDDE
RVVAVKVLKNVSRQSEEEFQAELSVIGRIYHMNLVRMWGCCSQAKHRILVSEYIENGSLA
QRLFDHGFDDDVLDWNQRFRIALGVAKGLAYLHSECSEWIVHCDMKPENILLDKDLEPKI
TDFGLSKLLNRDGSDAILTRIRGTRGYMAPEWVTNLPFTKKVDVYSYGVILLELVKGIRI
SEWVIHGIKVCEMDIRMVVRATRQKMESNEKRSIEDLVDYRLNGDFNHVQVKLMLEIAIS
CLEEDRSKRPNMNSVVQSLISVEGDADEPEQLFSARRPTAAGGNWGRNQALTLAEQMPTA
DAETVTSESTAVIQQDSTMFEKLDLEVDEDVVDEDICSIGNMTHEEEEADLERGIHSILK
NHPIMKKLNKGIHPVVLALHVLLEEEEEEEEEVVQEEDMAKGLAELDEYLSRHTYHTIEE
ATASFTGVIGRGGSGVVYKGVLDDERAVAVKVLKNSEEEFQAELSVIGRIYHMNLVRMWG
CCSQGKHRILVSEYIENGSLAHKLFGRDGFDDDVLDWNQRECSEWIVPCDLKPENILLDK
DLEPKITDFGLSKLLKRDGSDTILTRIRGTRGYMAPECVTNLPVIEKVDVYSYGVILLEL
VKEIWISEWVIHGIKVCEMDIRIVVRVTREKMESNEEKSIEDLVDYRLNGDFNHVQVKLM
LEIALSCLEEDRSKRPNMNSVVQALISFEALLCQTTHGCGRQLGEETRHLRLRLPLLAEQ
MPTADAETVTSESTAVIQQDSTMVNVDAAGLHEQDELPHWMSQLFEKLDLEVDEDVVDED
ICSIGNMTHEEEEADLERGIHSILKNHPIMKKLNKGIHPVVLALHVLLEEEEEEEEEVVQ
EEDMAKGLAELDEYLSRHTYHTIEEATASFTGVIGRGGSGVVYKGVLDDERAVAVKVLKN
SEEEFQAELSVIGRIYHMNLVRMWGCCSQGKHRILVSEYIENGSLAHKLFGLAYLHSECS
EWIVPCDLKPENILLDKDLEPKITDFGLSKLLKRDGSDTILTRIRGTRGYMAPECVTNLP
VIEKVDVYSYGVILLELVKEIWISEWVIHGIKVCEMDIRIVVRVTREKMESNEEKSIEDL
VDYRLNGDFNHVQVKLMLEIALSCLEEDRSKRPNMNSVVQALISFEAMSTSCSSSGALRA
AATKALLLVVFVSLSRPFPCTARDSLLRGASIAVEDHATDARLLMQLAVSCLEEDKNKRP
TMNHLQAEGCENEKNIVMNKDGCYHNIERHLGDQFPKRHSHCCQTVESADVNCICRTFTA
ADKAKIALSKWVNVAKVCDNPLHAGTNCAGYRVPMTYLFIRPLAGMVSNKYKDAVAVDKE
LTMQHHSHITKQIIATAMSKNCSRATATVPLLVVVVIFLSPSRPFPCEARRDSLPRGASI
AVEDHATDVLLSPDGTFAAGLYGVSPTVFTFSVWFARAAGRTVVWSANRARPVHSKRSRL
KLSGRRGALVLTDYDGEVVWNSTVSASATAARARLHDSGNLAIEDGSGNVLWQSFDHPTD
TLLPTQRIAAGEAMVSADKLLAAGFYSFRFSDYAMLSLVYDNHEMSSIYWPNPYYSYWQN
SRKIYNFTREAFFDASGHFSSSDNATFGAADLGKNVAVRRRLTLDTDGNLRLYSLDEVAG
TWLVSWMAFSNPCIIHGVCGANAVCLYSPAPVCVCAPGYARADPSDWSRGCRPTFNYTYG
GGRPPAMKLVALPHTDFWGFDINSSAHLSLHECTARCMSEPSCVVFEYKQGTGECYTKGL
MFNGRTHPAHLGTAYLKVPADLDMPELHVHQWQTNGLAIEEDIAGCSGSSSSEFLLDVSD
MSSSSSNNQGKSIWFYFYGFLSAIFVIEVFLIAMGCWIFSNKGVFRPSQVSVLEEGYRIV
TSHFRAYRYSELERRTKKFNNKIGHGGSGIVYKGSLDDERVVAVKVLQDVSQSEDVFQAE
LSVIGRIYHMNLVRMWGFCSEGTHRILVYEYIENGSLAKVLFDRRDSSKFLGWKQRFNIA
LGVAKGLAYLHNECLEWIIHCDMKPENILLDEDMEPKITDFGLSKLLNRDGSGSEMSRIR
GTRGYMAPEWVSSLPITEKVDVYSYGVVLLELVKGRRITEWVVDGKDGVETDVRSVVKMV
VDKLDSKNESWIMDLIDDQFGGEFNHLQAQLVIKLAISCLEEDRNRRPSMKYIVQMLISA
EDEAHAFT
Download sequence
Identical sequences A0A0D3HR22
OBART12G01840.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]