SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|526460559|ref|YP_008331136.1| from Arcobacter butzleri 7h1h

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|526460559|ref|YP_008331136.1|
Domain Number - Region: 87-117
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0133
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|526460559|ref|YP_008331136.1|
Sequence length 183
Comment DnaA-binding chromosome replication initiation factor [Arcobacter butzleri 7h1h]
Sequence
MQEFLNWTVDTIRKDKYLSPWLEEKKYEWTPLVSKNINNLLERNFSIIVITDKDREWFLE
YALTNINSTRLNRPFLPYYDFKSFYKYIDNVKSDEDISYIKDMLSISFPNGYCFWYIGKG
QDIRATIPKVLKNSFLWLFDEEKQDAFNLKSNDEALDMKLLQMFRLYNKTLSASLFAEIN
VEN
Download sequence
Identical sequences A0A0G9KFA4 A0A0G9KWJ1 S5P587
WP_020847965.1.19986 WP_020847965.1.36199 WP_020847965.1.40647 WP_020847965.1.75000 WP_020847965.1.8933 gi|526460559|ref|YP_008331136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]