SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|565647246|ref|YP_008898542.1| from Cronobacter sakazakii CMCC 45402

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565647246|ref|YP_008898542.1|
Domain Number 1 Region: 82-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.67e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0063
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.51e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|565647246|ref|YP_008898542.1|
Sequence length 213
Comment stringent starvation protein A [Cronobacter sakazakii CMCC 45402]
Sequence
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVETDNLPQDLIDLNPNQSVP
TLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYSLMNVIVSG
SAQEADNARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGVEFSGAGA
KELKGYMTRVFERDSFLASLTEAEREMRLQTRG
Download sequence
Identical sequences A0A0U4G1K4 K8C6H3 V5U4U9
WP_007780387.1.29613 WP_007780387.1.37109 WP_007780387.1.48341 WP_007780387.1.48695 WP_007780387.1.5266 WP_007780387.1.54861 WP_007780387.1.55414 WP_007780387.1.62682 WP_007780387.1.69775 WP_007780387.1.70259 WP_007780387.1.75988 WP_007780387.1.85350 WP_007780387.1.85926 WP_007780387.1.86471 WP_007780387.1.91071 gi|565647246|ref|YP_008898542.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]