SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pilcr1|698858|CE599358_7463 from Piloderma croceum F 1598 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pilcr1|698858|CE599358_7463
Domain Number 1 Region: 176-269
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000784
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pilcr1|698858|CE599358_7463
Sequence length 285
Sequence
MVVIEPQRPPTMLETKWAAEPFMITDSAERARRRSEARRQQAEEDRKAVQEEEERQRKLK
LKKQAIMEQEREDDFLRKVQLDKELRDAAAERMRREREIKEEEQARAWEVAEKKRIDKER
KAEEARKLEQWRVEEQKKSQELLKRQEGEIQRKEMERKARVKIIEAKIRKSSAAELMTGW
VTVQTSDALILTWKRRYFKFVGSKMFLYRTPKDISQPVDSMELGGRVSALREWHEGYEEL
EALDHSFALEFNDGQGPWSMFCDSEEDKVRILLVSNTASLTIVWF
Download sequence
Identical sequences A0A0C3F3S8
jgi|Pilcr1|698858|CE599358_7463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]