SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pilcr1|98005|fgenesh1_pm.00036_#_15 from Piloderma croceum F 1598 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pilcr1|98005|fgenesh1_pm.00036_#_15
Domain Number 1 Region: 22-127
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-25
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.001
Further Details:      
 
Domain Number 2 Region: 159-269
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000012
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pilcr1|98005|fgenesh1_pm.00036_#_15
Sequence length 368
Sequence
MPSQSTLSSDEKNKVKSAVPVSSFKIHTAALARIYFAYPEPSRWSYGGLQGALAFVHDKQ
KNIFSMKMVDLAGTRGVIWEHELYEGFEYFSDRPYFQSFAGDECMIGVVFAEESEAKTFY
KKVTGRKAEKSKAASSPTRKSAKNGKINKSMISGPASGSFRHVAHMGYDAEKGFTSTNVD
PSWTAFLGQLESQGVDKNLINENMDFIKDFVRDAQKTTPAAKKKPPPPPAPRRAAHGQSD
SFGSTHRDSAPAAPPQPPPARAPPPPPPPPPPGGSAAPPPIAAVLPPSQPGRGDLLASIR
GKSVNDLRKTDATSPPGRATPPPPPVEEAPSSSGGGSGDLTSALAAALLERNKKLGDSDD
EEEEEDWD
Download sequence
Identical sequences A0A0C3B1S8
jgi|Pilcr1|98005|fgenesh1_pm.00036_#_15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]