SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00000453g0008.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00000453g0008.1
Domain Number 1 Region: 539-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-74
Family Protein kinases, catalytic subunit 0.0000917
Further Details:      
 
Domain Number 2 Region: 96-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-25
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 
Weak hits

Sequence:  NbS00000453g0008.1
Domain Number - Region: 394-462
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00589
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00000453g0008.1
Sequence length 860
Comment protein AED:0.10 eAED:0.10 QI:0|0.71|0.62|1|0.71|0.62|8|0|860
Sequence
MKDFQIWMLKYTPLFSSHRMKATSNEGFKLFFLLCLFSIYQILGATDTITTTQFLKDGEL
NISSSGGNFEMGFFSPGNSRFRYFGIWYKNISVTTVVWVANREAPLSNTSGTVKVIKPGV
IVIVNETNHIIWSTNSSRSVQNPIAKLLNSGNLVVKEADVDDDKAGSFIWQSFDYPTDTL
LPSMKIGFNFVTGKEVYLSSWKNEEDPAPGDYTYHCDPSGYPQNILKKGSNVIYRSGPWN
GLRFSGAINSRESQFYTFGVFSTKTELLFSGATNSRESQFYTFGVFSTKTEVYFSYHLLA
SVVTRFILNQNGVLQRWTWGDRNKGWALYLALPTDNCDTYRLCGGYGSCNSLNSPVCGCL
DKFVPRIPEDWKKADWSSGCVRSAELNCLKGDVFLKYSKLKLPDTRNSWFNASMNLEECK
KICLKNCSCMAYSNLDIRNGGSGCLLWFEDLLDVRQLAKEGQDIYIRMAASELASQDKSN
GHKGKLLAFIIPLSAGVVLIFLSLVIFLRRRKRASEKKKGFWGCNYKMDYHTGNQSEEFE
LPLFDLSTIAKSTYNFSEESKIGEGGYGPVYKGVLEQGQEIAVKRLSKTSTQGQDEFKNE
VMYIVKLQHRNLVKILGCCIEGEEKMLIYEYMPNGSLDSFIFDDAGSRVLDWPKRFHIIN
GIARGLMYLHQDSRLRIIHRDLKANNILLDNDMNPKISDFGIARSCEDDNGYLSPEYAVH
GVYSVKSDVFSYGVLVLEIVSGKGNRRFSHPDHNLNLLGHAWKLFKEGRSMELLGFPIDV
HSTPEVIRSIHVGLLCVQHCPEDRPSMSSVVMMLNNEGELPLPKQPGFYVEANAPDNEFS
SSQYAHSTGNEITITVLDAR
Download sequence
Identical sequences NbS00000453g0008.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]